DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lds and kis

DIOPT Version :8

Sequence 1:NP_524850.2 Gene:lds / 45894 FlyBaseID:FBgn0002542 Length:1061 Species:Drosophila melanogaster
Sequence 2:NP_001137761.1 Gene:kis / 33185 FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster

Alignment Length:1166 Identity:260/1166 - (22%)
Similarity:422/1166 - (36%) Gaps:369/1166 - (31%)


  Fly     1 MSSE-NSEYYSDKEEDSVVNNSSLGRSRKSSRLSKSSRLSKSSRPSSAGVVIDETQSEEEESQSS 64
            |||: |..|.:..:|||:|....|........|.......|:..|..     ||.:||.:|:   
  Fly  1628 MSSKPNYVYINTGDEDSMVVQLVLAMRMGKRELILDKPKEKAPEPKQ-----DEEKSELDEA--- 1684

  Fly    65 ETAESEKSDESDNSQNSQESE--DSEDDSVRPSARNTKRKPLGIPSDSEDEEDELEQRALSPSTR 127
             |.:..:.||...::...:.:  |||:..:..||.....|....|.||:..:::           
  Fly  1685 -TTDKPEGDEKFKTEGESKKDLTDSEETKLESSAMEVDSKEESEPDDSKKSDED----------- 1737

  Fly   128 MSITGVRPQDLSDDDSEIEYSDEVQEGPTEAPTAEAVVPRYTTQFAGNIQNDLHSTIGAAD---- 188
                       :.|..::|..|||.:...|:...|......|.:.:..|:.|..||:..||    
  Fly  1738 -----------NKDKDKMEVDDEVGKSDKESKPEEQSETVKTEENSKAIEEDKSSTVLTADHAKE 1791

  Fly   189 -SEVL-----DDSSGSDVLILSNKETPIEILSSTDD----DATT--NKENMSGPPFERPSKSLSP 241
             ..||     |:.:..|...:|..|...|  .||||    :|||  |||::.       .:....
  Fly  1792 PETVLEKMEVDEKANDDQSAVSKAEGSDE--KSTDDSNPEEATTEKNKESLE-------IEGEKE 1847

  Fly   242 RSSAGASVVKTS---------KNLSQP-----------------------TIQAVLKQKTSPAAP 274
            |...|...||..         :|..:|                       |.:.:||.....||.
  Fly  1848 RVKEGEESVKKENDEKTEADMENKPEPVFIDVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAK 1912

  Fly   275 -RRSRIKSEDQKVVSQVVYDE-------EMRKLAEKRVQVSDAEKLFEKVAHKLPDKGSQIMKRI 331
             ||.:.|...|..:.:.:.||       |:.::.:..|...:...  |...|.|. |...:....
  Fly  1913 IRRFQQKQSQQLNIFENIEDEPFNQDFTEVDRVLDMSVHTDETSG--ETTKHYLV-KWKSLPYED 1974

  Fly   332 DTLRRELAMD----EQWISALRV-QQSNVPAVRVVKPTLNPPRAPSIDTLDWDELSEAVNEIKPV 391
            .|...|..:|    ||::...:: |:|...:.:...|.|            |.:|     |..||
  Fly  1975 CTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPEL------------WKKL-----EKTPV 2022

  Fly   392 YTGAQGMATFNNQKALTLESLKDLHVSLEDLPGPEVLAEDPVGLKVSLMNHQKHALAWM--SWRE 454
            |.|..                                         ||..:|...|.|:  ||..
  Fly  2023 YKGGN-----------------------------------------SLRPYQLEGLNWLKFSWYN 2046

  Fly   455 RKLPRGGILADDMGLGKT---LTMISSVLACKNGQEMSEGKDESSDSDSEDDKNKKRKSVTGWKS 516
               ....||||:||||||   ||.:.||.                                    
  Fly  2047 ---THNCILADEMGLGKTIQSLTFVHSVY------------------------------------ 2072

  Fly   517 KGRKDTRRGGTLVVCPASLLRQWESEVESKVSRQKLTVCVHHGN-------------NRETKGKY 568
               :...||..||:.|.|.:..|:.|.|....   :.|.|:||:             .:...||.
  Fly  2073 ---EYGIRGPFLVIAPLSTIPNWQREFEGWTD---MNVVVYHGSVTSKQMIQDYEYYYKTESGKV 2131

  Fly   569 LRD---YDIVVTTYQIVAREHKSLSAVFGVKWRRIILDEAHVVRNHKSQSSLAVCDLRGKYRWAL 630
            |::   :::::||::::..::..|.|   ..||..::||||.::|...:....:..|..::|..|
  Fly  2132 LKEPIKFNVLITTFEMIVTDYMDLKA---FNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLL 2193

  Fly   631 TGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDN-KSAGGQNRLNLLMKSLMLRRTKAQLQSD 694
            :|||:||...::::||.||..|.|.....:.....: ::....|:|..|:|.:||||.|..::  
  Fly  2194 SGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVE-- 2256

  Fly   695 GKLNSLPNKELRLIEISLDKEEMNVYQTVMTYSRTLFAQFLHQRAERETDFNY----RSDANKPT 755
               .||..||..:||:.|...:...|:.::                 |.:|::    .:.||.| 
  Fly  2257 ---KSLAPKEETIIEVELTNIQKKYYRGIL-----------------EQNFSFLKKGTTSANIP- 2300

  Fly   756 YNQIKDPNGAYYKMHEKFARMAGSKKEVKSHDILVLLLRLRQICCHPGLIDAMLDGEESQTMGD- 819
                                           :::..::.||:.|.||.|    |:|.|.|...| 
  Fly  2301 -------------------------------NLMNTMMELRKCCIHPYL----LNGAEEQIQYDF 2330

  Fly   820 ---HSSDSDTPEIDLLAQLNKLAITDTSTDGQQSVANAGDDGPPLLPDEARIAKASKNLLKRSNP 881
               |..|.::...:|:....|:.:.|                 .|||.                 
  Fly  2331 KSQHGEDPESYYKNLILSAGKMVLID-----------------KLLPK----------------- 2361

  Fly   882 VFNLHRPSSKINMVIQILKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSLNGTIPVKN 946
                                  ||::..:.::.||....||||.|:|.........::|.|....
  Fly  2362 ----------------------LKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNL 2404

  Fly   947 RQDIVNEFNDRNNQKRVLLLSLTAGGVGLNLIGANHLLLLDLHWNPQLEAQAQDRIYRVGQKKNV 1011
            ||:.::.::...:.:.|.||...|||:|:||..|:.:::.|..||||.:.|||.|.:|:||:|.|
  Fly  2405 RQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQRKMV 2469

  Fly  1012 IIYKFMCVDTVEQRIKGLQDKKLDLADGVLTGA----------KVSSKLTIDDL--KGLFG 1060
            .||:.:|.:|.|:.:......||.|...||...          |..||..|:||  ||.:|
  Fly  2470 KIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLKKGAYG 2530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ldsNP_524850.2 SNF2_N 442..805 CDD:278600 87/388 (22%)
DEXDc 459..634 CDD:238005 45/193 (23%)
HELICc 885..1014 CDD:238034 38/128 (30%)
kisNP_001137761.1 BASP1 1554..1786 CDD:283191 42/188 (22%)
HepA 1676..2527 CDD:223627 243/1108 (22%)
SDA1 <1693..>1854 CDD:283052 43/191 (23%)
CHROMO <1879..1919 CDD:237991 7/39 (18%)
Chromo 1941..1996 CDD:278797 11/57 (19%)
DEXDc 2048..2197 CDD:238005 45/193 (23%)
Helicase_C 2350..2464 CDD:278689 39/169 (23%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138579391
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.