DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lds and Hltf

DIOPT Version :8

Sequence 1:NP_524850.2 Gene:lds / 45894 FlyBaseID:FBgn0002542 Length:1061 Species:Drosophila melanogaster
Sequence 2:XP_006232237.1 Gene:Hltf / 295568 RGDID:1309031 Length:1018 Species:Rattus norvegicus

Alignment Length:899 Identity:244/899 - (27%)
Similarity:351/899 - (39%) Gaps:321/899 - (35%)


  Fly   389 KPVYTGAQGMATFNNQKALTLESLK-DLHVSLEDLPGPE--VLAEDPVGLKVSLMNHQKHALAWM 450
            :||:...|          :|.|.|| :.....|||...:  :..|....::..|:.|||.|||||
  Rat   197 RPVHVAVQ----------MTTEQLKTEFDKLFEDLKEDDRTIEMEPAEAVETPLLPHQKQALAWM 251

  Fly   451 SWRE--RKLP--------------------------RGGILADDMGLGKTLTMISSVLA------ 481
            ..||  ::||                          .|||||||||||||||.|:.:|.      
  Rat   252 IARENSKELPPFWELRNDLYYNTITNFSVKERPENVHGGILADDMGLGKTLTAIAVILTNFDDGR 316

  Fly   482 ---CKNGQEMSEGK----------------------------DESSDSDSEDDKN---------K 506
               .|.|:|...||                            :|.|.||..:..|         |
  Rat   317 PLLGKRGKESHPGKEYKDETVKLRGSNTNKTTDGHSEPSACSEEPSISDVSEKSNVSDLFSFFSK 381

  Fly   507 KRK----------------SVTGWKSKG-------------------RKDT-------------- 522
            :||                |....|.||                   ::||              
  Rat   382 RRKISVQSTESSESEEIETSKLSQKMKGKLKNTQLDTKSKVKGSSKIKEDTQFALALTYFGPATK 446

  Fly   523 ---------------------RRGGTLVVCPASLLRQW-----------------------ESEV 543
                                 |...||::||.|:|..|                       :|||
  Rat   447 KKMLKKGTSVMESSKKCDTGERTRTTLIICPLSVLSNWILFSLISLRFFMKYTQDQIGQHIKSEV 511

  Fly   544 ESKVSRQKLTVCVHHGNNRETKGKYLRDYDIVVTTYQIVAREH--KSLSAVFGVKWRRIILDEAH 606
            :       |.:.|::|.:|.....:|...||::|||.|:..::  |..|.:..:||.|:||||.|
  Rat   512 D-------LNLYVYYGPDRIRDSTWLSKQDIILTTYNILTHDYGTKDNSPLHSIKWLRVILDEGH 569

  Fly   607 VVRNHKSQSSLAVCDLRGKYRWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNK---- 667
            .:||..:|.:.||.:|..:.||.||||||||...|:::||.||:..||.|...|.:.|...    
  Rat   570 AIRNPNAQQTKAVLELEAERRWVLTGTPIQNSLKDLWSLLSFLKLKPFTDREWWHRIIQRPVTTG 634

  Fly   668 SAGGQNRLNLLMKSLMLRRTKAQLQSDGKLNSLPNKELRLIEISLDKEEMNVYQTVMTYSRTLFA 732
            ..||..||..|:||:.|||||........:..||.:::.:..|:|..||..:||:|....:...|
  Rat   635 DEGGLRRLQSLIKSITLRRTKTSKIKGKPVLELPERKVFIQHITLSVEERKIYQSVKNEGKATIA 699

  Fly   733 QFLHQRAERETDFNYRSDANKPTYNQIKDPNGAYYKMHEKFARMAGSKKEVKSH--DILVLLLRL 795
            ::.                                           ::..|.:|  |:|.|||||
  Rat   700 RYF-------------------------------------------TEGTVLAHYADVLGLLLRL 721

  Fly   796 RQICCHPGLIDAMLDGEESQTMGDHSSD---SDTPEIDLLAQLNKLAITDTSTDGQQSVANAGDD 857
            ||||||..|          .|.|..|||   |||||     :|.|:.:|.     .:.:.::|.|
  Rat   722 RQICCHVHL----------PTNGTSSSDPSRSDTPE-----ELRKMLVTK-----MKLILSSGSD 766

  Fly   858 GPPLLPDEARIAKASK------------------NLLKRSNP-------VFNLH----------- 886
                  :|..|...|.                  .:::|..|       ..|:|           
  Rat   767 ------EECSICLDSLTFPVITHCAHVFCKPCICQVIQREQPHAKCPLCRSNIHGHNLLECPPEE 825

  Fly   887 -------------RPSSKINMVIQILKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSL 938
                         ..|||||.::..|.....|..:.|::||||:|:.|.::...|...|.....|
  Rat   826 LACDSDNKSDMEWTSSSKINALMNALIELRTKDPNIKSLVVSQFTTFLSLIETPLKASGFVFTRL 890

  Fly   939 NGTIPVKNRQDIVNEF-NDRNNQKRVLLLSLTAGGVGLNLIGANHLLLLDLHWNPQLEAQAQDRI 1002
            :|::..|.|.:.:..| |.......::||||.||||||||..|:.:.|:|..|||..|.|..||.
  Rat   891 DGSMAQKKRVESIQCFQNTDAGSPTIMLLSLKAGGVGLNLCAASRVFLMDPAWNPAAEDQCFDRC 955

  Fly  1003 YRVGQKKNVIIYKFMCVDTVEQRIKGLQDKKLDLADGVLTGAKVSSKLTIDDLK 1056
            :|:|||:.|||.||:..|:||:.:..:|:.|.:||.|.. |.|   |...|::|
  Rat   956 HRLGQKQEVIITKFIVKDSVEENMLKIQNMKRELAAGAF-GTK---KTDADEMK 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ldsNP_524850.2 SNF2_N 442..805 CDD:278600 143/537 (27%)
DEXDc 459..634 CDD:238005 79/315 (25%)
HELICc 885..1014 CDD:238034 51/153 (33%)
HltfXP_006232237.1 HIRAN 60..155 CDD:285949
DEXDc 238..>316 CDD:214692 30/77 (39%)
SNF2_N 472..727 CDD:278600 92/304 (30%)
DEXDc <472..597 CDD:238005 42/131 (32%)
RING 768..813 CDD:238093 5/44 (11%)
Helicase_C 841..959 CDD:278689 45/117 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D132523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.