DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ix and med29

Sequence 1:NP_610677.1 Gene:ix FlyBaseID:FBgn0001276 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001072872.1 Gene:med29 XenbaseID:XB-GENE-1006668 Length:188 Species:Xenopus tropicalis

Alignment Length:189 Identity:63/190 (33%)
Similarity:91/190 (48%) Gaps:34/190 (18%)


  Fly    16 MQVMQSSPS-------------GPPGPVQHQQQQPPQPLQQQQQAEKLDNISRVKSLLGPLRESM 67
            |.:.||.|.             ||..||..||||    |..|||.:..|.:.|.:.|:..|:||:
 Frog     3 MLLNQSQPPQGREGGGTQVGSLGPGIPVGQQQQQ----LGLQQQQQDFDPVQRYRMLIPQLKESL 63

  Fly    68 FLTIRSSAFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQCLQQQNSSNH 132
            ...::.:|..|.||...||.:::... .|.||||.||:|||.|||:|:.|:.|.:||.|...|..
 Frog    64 QNLMKIAAQNLVQNTNIDNGQKNADG-LVQRFDKSLEEFYAICDQLELCLRLAYECLSQSYDSAK 127

  Fly   133 YLPGPVTPMRMETFMPDNAGP-------ISYPTYLNTVRVHIQSAKDIHDTLISAAQNI 184
            :.|         |.:|....|       :.|..||:.::..|..|||||:.|:..::.|
 Frog   128 HSP---------TLVPTATKPDAVQTESLPYTQYLSMIKSQISCAKDIHNALLECSKKI 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ixNP_610677.1 Med29 48..186 CDD:288425 47/145 (32%)
med29NP_001072872.1 Med29 45..177 CDD:314458 46/142 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28J9T
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I4872
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480686at2759
OrthoFinder 1 1.000 FOG0007515
OrthoInspector 1 1.000 T1059177
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4650
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.