DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ix and Med29

Sequence 1:NP_610677.1 Gene:ix FlyBaseID:FBgn0001276 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_080318.2 Gene:Med29 MGIID:1914474 Length:199 Species:Mus musculus

Alignment Length:194 Identity:69/195 (35%)
Similarity:97/195 (50%) Gaps:27/195 (14%)


  Fly    10 MSGPQMMQVMQSSPS--------GPPGPVQHQQQQPPQPLQ---------QQQQAEKLDNISRVK 57
            |:.||......||.|        |.|||     ||.|||.|         .|||.:..|.:.|.|
Mouse     1 MAAPQPQAAAVSSASGVSGPGSAGGPGP-----QQQPQPTQLVGSAQSGLLQQQQQDFDPVQRYK 60

  Fly    58 SLLGPLRESMFLTIRSSAFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQ 122
            .|:..|:||:...::.:|..|.||...||.::.:.| .:.||||.||:|||.|||:|:.|:.|.:
Mouse    61 MLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDA-PLQRFDKCLEEFYALCDQLELCLRLAHE 124

  Fly   123 CLQQQNSSNHYLPGPV-TPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNIS 185
            ||.|...|..:.|..| |..:.:...||:   :.||.||..::..|..|||||..|:..|..::
Mouse   125 CLSQSCDSAKHSPTLVPTATKPDAVQPDS---LPYPQYLAVIKAQITCAKDIHTALLDCANKVT 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ixNP_610677.1 Med29 48..186 CDD:288425 50/140 (36%)
Med29NP_080318.2 Med29 52..186 CDD:314458 50/139 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28J9T
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007515
OrthoInspector 1 1.000 T1083157
orthoMCL 1 0.900 OOG5_136872
Panther 1 1.100 LDO PTHR28314
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4650
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.