DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ix and Med29

Sequence 1:NP_610677.1 Gene:ix FlyBaseID:FBgn0001276 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001099707.1 Gene:Med29 RGDID:1311009 Length:199 Species:Rattus norvegicus

Alignment Length:194 Identity:69/195 (35%)
Similarity:97/195 (50%) Gaps:27/195 (14%)


  Fly    10 MSGPQMMQVMQSSP---SGP-----PGPVQHQQQQPPQPLQ---------QQQQAEKLDNISRVK 57
            |:.||......||.   |||     |||     ||.|||.|         .|||.:..|.:.|.|
  Rat     1 MAAPQPQAAAVSSAAGVSGPGSAGGPGP-----QQQPQPTQLVGAAQSGLLQQQQQDFDPVQRYK 60

  Fly    58 SLLGPLRESMFLTIRSSAFALQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQ 122
            .|:..|:||:...::.:|..|.||...||.::.:.. .:.||||.||:|||.|||:|:.|:.|.:
  Rat    61 MLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDG-PIQRFDKCLEEFYALCDQLELCLRLAHE 124

  Fly   123 CLQQQNSSNHYLPGPV-TPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNIS 185
            ||.|...|..:.|..| |..:.:...||:   :.||.||..::..|..|||||..|:..|..::
  Rat   125 CLSQSCDSAKHSPTLVPTATKPDAVQPDS---LPYPQYLAVIKAQITCAKDIHTALLDCANKVT 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ixNP_610677.1 Med29 48..186 CDD:288425 49/140 (35%)
Med29NP_001099707.1 Med29 52..186 CDD:288425 49/139 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28J9T
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I4851
OMA 1 1.010
OrthoDB 1 1.010 D1480686at2759
OrthoFinder 1 1.000 FOG0007515
OrthoInspector 1 1.000 T1086728
orthoMCL 1 0.900 OOG5_136872
Panther 1 1.100 LDO PTHR28314
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.840

Return to query results.
Submit another query.