DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpo and snf

DIOPT Version :10

Sequence 1:NP_001014632.3 Gene:cpo / 45840 FlyBaseID:FBgn0263995 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster


Alignment Length:139 Identity:36/139 - (25%)
Similarity:56/139 - (40%) Gaps:36/139 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 PATSAVSDSNNNLNSSSSSNSNSNAIME---NQMALAPLGLSQSMDSVNTASNEEEVRTLFVSGL 449
            ||.......:.....||:.|||.||..|   ||:                         ||::.|
  Fly   110 PAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQI-------------------------LFLTNL 149

  Fly   450 PMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMP 514
            |.:.....|.:||..:.|::...| |.:::     .:.||.|.|...:.|||:.|||.:..|  .
  Fly   150 PEETNEMMLSMLFNQFPGFKEVRL-VPNRH-----DIAFVEFTTELQSNAAKEALQGFKITP--T 206

  Fly   515 QTIRLEFAK 523
            ..:::.|||
  Fly   207 HAMKITFAK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpoNP_001014632.3 RRM_cpo 441..523 CDD:410085 22/81 (27%)
RRM_scw1_like 712..819 CDD:409691
snfNP_511045.1 RRM1_SNF 1..85 CDD:409905
RRM2_SNF 137..216 CDD:240923 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.