DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d14 and Cyp6a23

Sequence 1:NP_001259179.1 Gene:Cyp4d14 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster

Alignment Length:541 Identity:129/542 (24%)
Similarity:239/542 (44%) Gaps:88/542 (16%)


  Fly     1 MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLINESPKSKSSIFDMQFR 65
            :.|.|.|:|::..|   :|.:|||. .:...||.....:|:.||    :.:.||.:.  ..|.||
  Fly     3 LLLTLIALLVSLLL---FMARRRHG-YWQRRGIPHDVPHPIYGN----MKDWPKKRH--IAMIFR 57

  Fly    66 LIAEFGKNIKTQMLGESGF--------MTADSKMIEAIMSSQQTIQKNN--LYSLLVNWLGDGLL 120
               ::....|..:...:||        :..|.::::.::.......:|.  .|:.:.:.|...|.
  Fly    58 ---DYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLF 119

  Fly   121 ISQGKKWFRRRKIITPAFH-----------FKILEDFVEVFDQQSATMVQKLYDRADGKTVINMF 174
            ..:|:||...|..:||.|.           .|:.|:..::|..::.|        .:|: |:.:.
  Fly   120 SIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTT--------GEGQ-VLEIV 175

  Fly   175 PVACLCAMDIIAETAMGVKINAQLQPQFTYVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLD 239
            .:......|:|...|.|:..|:...|.   .:.||.....:.||....|  |||.: ..:|||..
  Fly   176 DLVARYTADVIGNCAFGLNCNSLQNPN---AEFVTIGKRAIIERRYGGL--LDFLI-FGFPKLSR 234

  Fly   240 ----KLNDAVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLK----- 295
                |||  |:::.||..|::....:...:.                .::|...:|.|::     
  Fly   235 RLRLKLN--VQDVEDFYTSIVRNTIDYRLRT----------------NEKRHDFMDSLIEMYEKE 281

  Fly   296 ---STIDGAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKS 357
               :|.||  ||.::|..:...|...|.:|:::::.|..|.||...::|.::..|:.:|:....:
  Fly   282 QAGNTEDG--LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNN 344

  Fly   358 APVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQD-TVLDGK-LIPADSNVIILIYHAQRDP 420
             ..|.:.:.|:||||.|:.|:||.:|.:..:.|....| :..|.| .|...:.|:|.......||
  Fly   345 -EFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDP 408

  Fly   421 DYFPDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPLGE 485
            :.:|:||||.|:||:.|.........:.||..|||||||.:|.:::....::.::|.::.....|
  Fly   409 EIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTE 473

  Fly   486 EVQP----VLNVILRSTTGIN 502
            ...|    |.:::|.:..||:
  Fly   474 TQIPMKFVVKSILLSAENGIH 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 113/490 (23%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 118/505 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.