DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dom and INO80

Sequence 1:NP_001286676.1 Gene:dom FlyBaseID:FBgn0020306 Length:3233 Species:Drosophila melanogaster
Sequence 2:NP_011365.1 Gene:INO80 SGDID:S000003118 Length:1489 Species:Saccharomyces cerevisiae

Alignment Length:1442 Identity:375/1443 (26%)
Similarity:586/1443 (41%) Gaps:500/1443 (35%)


  Fly   533 REGLWTERRLPKLQEPSRPKAHWDYLLEEMVWLAADFAQERKWKKNAAK---KCAKMVQKYFQDK 594
            |.||.|.......:|....:.|:|.....:            ||..|.|   |.:::||:....:
Yeast   447 RHGLPTYGMKMNAKEARAIQRHYDNTYTTI------------WKDMARKDSTKMSRLVQQIQSIR 499

  Fly   595 AT--------AAQRAEKAQELQLKRVASFIA------REVKSFW-----------SNVEKLVEYK 634
            :|        .|:.|:|.|....|::..|..      ||:.:||           ..:||  |..
Yeast   500 STNFRKTSSLCAREAKKWQSKNFKQIKDFQTRARRGIREMSNFWKKNEREERDLKKKIEK--EAM 562

  Fly   635 HQTKIEEKRKQALDQ--HLSFIVDQTEKFSQQL--------VEGMNKSVADTPSLNSSRLTSPKR 689
            .|.|.||:.|::..|  .|:|::.|||.:|..:        :||.|.|..|:.|..:..:::...
Yeast   563 EQAKKEEEEKESKRQAKKLNFLLTQTELYSHFIGRKIKTNELEGNNVSSNDSESQKNIDISALAP 627

  Fly   690 ESDDDFRPESGSEDDEETIAKAEEDAADVKEEVTALAKESEMDFDDFLNDLPPGYLENRDKLMKE 754
            ..:|....:..:|:||:...:|.|:|::...|..|.||:    |||..|                
Yeast   628 NKNDFHAIDFDNENDEQLRLRAAENASNALAETRAKAKQ----FDDHAN---------------- 672

  Fly   755 EQSSAIKTETPDDSDDSEFEAKEASDDDENTISKQEEAEQEIDHKKEIDELEADNDLSVEQLLAK 819
                                             ..||.|:|       |||...|..|:.::   
Yeast   673 ---------------------------------AHEEEEEE-------DELNFQNPTSLGEI--- 694

  Fly   820 YKSEQPPSPKRRKLAPRDPELDSDDDSTAVDSTEESEDAATEDEEDLSTVKTDTDMEEQDEQEDG 884
                                                            |::              
Yeast   695 ------------------------------------------------TIE-------------- 697

  Fly   885 LKSLMADADATSGAAGSGSTAGASGNKDDMLNDAAALAESLQPKGNTLSSTNVVTPVPFLLKHSL 949
                                                     |||               :|..:|
Yeast   698 -----------------------------------------QPK---------------ILACTL 706

  Fly   950 REYQHIGLDWLVTMNERKLNGILADEMGLGKTIQTIALLAHLACAKGNWGPHLIVVPSSVMLNWE 1014
            :|||..||:||..:.::.:|||||||||||||:|:|::|||||.....|||.|:|.|:|.:.||.
Yeast   707 KEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENHNIWGPFLVVTPASTLHNWV 771

  Fly  1015 MEFKKWCPGFKILTYYGSQKERKLKRVGWTKPN-------AFHVCITSYKLVVQDQQSFRRKKWK 1072
            .|..|:.|.||||.|:|:..:||:.|..|.:.|       .|||.:|||::||.|....::.||:
Yeast   772 NEISKFLPQFKILPYWGNANDRKVLRKFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKMKWQ 836

  Fly  1073 YLILDEAQNIKNFKSQRWQLLLNFSTERRLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEW 1137
            |:||||||.||:.:|.||:.||:|....||||||||:||.:.|||:|:||:||.:|.||.||.||
Yeast   837 YMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSHDEFNEW 901

  Fly  1138 FSNPMTGMIEGNMEYNETLITRLHKVIRPFLLRRLKKEVEKQMPKKYEHVITCRLSNRQRYLYE- 1201
            ||..:....|.|.:.|:..:.|||.:::||:|||:||.|:.::..|.|..:.|.|:.||..||: 
Yeast   902 FSKDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQV 966

  Fly  1202 ---------DFMSRAKTRETL-----QTGNLLSVINVLMQLRKVCNHPNMFEARPTISPFQMDGI 1252
                     |.:..|.|.::.     .:|:..::||.:||.|||||||::||.....|||.    
Yeast   967 LKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQFRKVCNHPDLFERADVDSPFS---- 1027

  Fly  1253 TFHTPRLVCDIMEYDPFTQINLETLNLLLLHLEQTMTAYVSHKSRLLAPPRKLIEDIDTAPLPAP 1317
                            ||... :|.::|...:....::.:|:            .:::.:.:.:.
Yeast  1028 ----------------FTTFG-KTTSMLTASVANNNSSVISN------------SNMNLSSMSSN 1063

  Fly  1318 RCPNGKYRFHIRVRSAELAQRIKLNAVKVGASPAMRLEGSKIMPMRNLLPSGRVLKRVSASINPV 1382
            ...|||:                                      .:|:.|.|         ||:
Yeast  1064 NISNGKF--------------------------------------TDLIYSSR---------NPI 1081

  Fly  1383 NMALKPVVINSVVTTTSSSTTASSPTGALSVLSNSKLLGARSQINAPTPAKVAKTMQDGKPFFYL 1447
            ..:|..::...::..                             |......:|..:::.| |...
Yeast  1082 KYSLPRLIYEDLILP-----------------------------NYNNDVDIANKLKNVK-FNIF 1116

  Fly  1448 TPATNSGAAGARLTL-TSKTTASASTTTSRTTVTASTTSGQQLIRDPIVKDLATHVKSTVQKQSI 1511
            .|:||     ..|.| .||.|...|.   ......|||        |::|.:...........|:
Yeast  1117 NPSTN-----YELCLFLSKLTGEPSL---NEFFRVSTT--------PLLKRVIERTNGPKNTDSL 1165

  Fly  1512 ANGKTEPEEETEAEDPYK--VQELIQMRKEQRLAALKRMAMINRRRTDATPIYGEDCREAIQRCM 1574
            :               :|  .|||:::                   |...|..|         .|
Yeast  1166 S---------------FKTITQELLEV-------------------TRNAPSEG---------VM 1187

  Fly  1575 QATRSLKRSTWQTRGYANCCTAMAHRNGWSLNHLLKSFEERCADLKPVFANFVIYVPSVCAPRIR 1639
            .:..::::..:: |.|.||.     :.|                          |.|:|.||.:.
Yeast  1188 ASLLNVEKHAYE-REYLNCI-----QRG--------------------------YHPNVSAPPVT 1220

  Fly  1640 RYVQNLSSTHWQ---HEQRIENIVDQALR---------------------PKLALL-HPIISEMT 1679
              ::.|.|:|..   :.:..:.::.|||.                     ||..|. .|:....:
Yeast  1221 --IEVLGSSHVTNSINNELFDPLISQALSDIPAITQYNMHVKKGIPVEDFPKTGLFPEPLNKNFS 1283

  Fly  1680 TKFPDPRLIQY--DCGKLQTMDRLLRQLKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGS 1742
            :....|.:.::  :..||:.:|.||.:||..||||||:.|||||:|::|.:|.|..:.::|||||
Yeast  1284 SNISMPSMDRFITESAKLRKLDELLVKLKSEGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGS 1348

  Fly  1743 TRVEQRQILMERFNGDKRIFCFILSTRSGGVGINLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQ 1807
            :::|.|:.|:..:..:..||.|:||||:||:|||||.||||||||||||||:|:||.||.||:||
Yeast  1349 SKLEDRRDLVHDWQTNPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQ 1413

  Fly  1808 TRDVHIYRLVSERTIEVNILKKANQKRMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSEQD-ESS 1871
            ||.|.:|||:...|||..:..:|.||..:..:.:||         .:..|::.|:|..|.| |.:
Yeast  1414 TRQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEG---------KTQEKNIKTIEVGENDSEVT 1469

  Fly  1872 QE--KSENKDRI 1881
            :|  ||.::|.|
Yeast  1470 REGSKSISQDGI 1481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
domNP_001286676.1 HSA 543..614 CDD:214727 16/82 (20%)
ASF1_hist_chap <674..831 CDD:304562 26/157 (17%)
FAM176 <824..>868 CDD:291517 0/44 (0%)
SNF2_N 952..1238 CDD:278600 139/308 (45%)
DEXDc 969..1108 CDD:238005 76/146 (52%)
Helicase_C 1692..1806 CDD:278689 65/114 (57%)
INO80NP_011365.1 DBINO 469..602 CDD:290603 34/147 (23%)
SNF2_N 709..1017 CDD:278600 139/308 (45%)
DEXDc 726..872 CDD:238005 76/146 (52%)
Helicase_C 1298..1412 CDD:278689 65/114 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.