DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dom and Srcap

Sequence 1:NP_001286676.1 Gene:dom FlyBaseID:FBgn0020306 Length:3233 Species:Drosophila melanogaster
Sequence 2:XP_017445721.1 Gene:Srcap RGDID:1565642 Length:3266 Species:Rattus norvegicus

Alignment Length:3380 Identity:997/3381 (29%)
Similarity:1353/3381 (40%) Gaps:1252/3381 (37%)


  Fly   410 PAPPAAVGNPSVPL---------VPGGTPLLPCNTSAGSTALRRPQGQNNASSGSAAASGGGGSL 465
            |:|    .:|.:|:         :.|..|:.|                  |||.|.|:||.|| :
  Rat     5 PSP----AHPQLPILQTQMVSDGMTGSNPVSP------------------ASSSSPASSGAGG-I 46

  Fly   466 TPTPLYTGNGPAALGGSGGLTPGT--PTSGSLLSPA---LGGGSGTPNSAAQEFSFKAKQEVYVM 525
            :|..:..   .::|.|..|...||  |..|..||.|   :..|.....|.| |.:.:||.|..:.
  Rat    47 SPQHIAQ---DSSLDGPPGPQDGTTVPLEGFSLSHAADPINRGPKWEKSHA-EIAEQAKHEAEIE 107

  Fly   526 QRISELQREGLWTERRLPKLQEPSRPKAHWDYLLEEMVWLAADFAQERKWKKNAAKKCAKMVQKY 590
            .||:||::||.|:.:||||:.||.|||.|||||.|||.||:|||||||:||:..|:|..:||.::
  Rat   108 TRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKVVRMVIRH 172

  Fly   591 FQDKATAAQRAEKAQELQLKRVASFIAREVKSFWSNVEKLVEYKHQTKIEEKRKQALDQHLSFIV 655
            .:::....:||.:.::.:|:|:||.:|::|:.|||||||:|::|.|:::|||||:|||.||.|||
  Rat   173 HEEQRQKEERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIV 237

  Fly   656 DQTEKFSQQLVEGMNKSVA-----DTPSLNSSRLTS----PKRESDD---DFRP-ESGSEDDEET 707
            .||||:|..|.:.:|:.:|     .:|.|.||...|    |....||   ||:| |...||||||
  Rat   238 GQTEKYSDLLSQSLNQPLASSKAGSSPCLGSSSAASSPPPPVSRLDDEDGDFQPQEEEEEDDEET 302

  Fly   708 IAKAEE----DAADVKEEVTALAKESEMDFDDFLNDLPPGYL-----------------ENRDKL 751
            |...|:    ||...:.|:..|..|.|:..::.|..|||..|                 :..::.
  Rat   303 IEVEEQQEGNDAETQRREIELLRHEGELPLEELLRSLPPQLLGGPFSPSQTPSHDSDTPDGPEEN 367

  Fly   752 MKEEQSSAIKTETPD-------------DSDDSEFEAKE-ASDDDENTISKQEEAEQEIDHKKEI 802
            ::||.|..::.:.|.             |.||.||.|.| .::|:|:||:.:|:.|.|:||..|:
  Rat   368 IEEEPSQDLEVDPPSSSVTQCNKQCWHPDEDDEEFTANEDEAEDEEDTIAAEEQLEGEVDHAMEL 432

  Fly   803 DELEADNDLSVEQLLAKYK-----------SEQPPSPKRRKLAPRDPELD---------SDDDST 847
            .||..:.:||:|:||.:|.           |......:..:....|.||:         .:|.|:
  Rat   433 SELAREGELSMEELLQQYAGAYAYDASAPGSGNSEDEEEVEANSSDCELEETRDVEEAAQEDSSS 497

  Fly   848 AVDSTEE-------------------SEDAATEDEEDLSTVKTDTDMEEQDEQED-----GLKSL 888
            ..||.||                   ||::.:::.||..: ::..|.|::||.:|     |::.|
  Rat   498 QSDSAEEHSEDEEDEHSEEEMSGSSQSEESESDESEDAQS-QSQADEEQEDEGDDDDDDFGVEYL 561

  Fly   889 MA------DADATSGAAGSGSTAGASGNKDDMLNDAAALAESLQPKGNTLSSTNVVTPVPFLLKH 947
            :|      :.|..||....|.|......|:  :.|.||.||||||||.||::|.|.||:|.||:.
  Rat   562 LARDDERSEVDGGSGPPTPGPTTTLGPKKE--ITDIAAAAESLQPKGYTLATTQVKTPIPLLLRG 624

  Fly   948 SLREYQHIGLDWLVTMNERKLNGILADEMGLGKTIQTIALLAHLACAKGNWGPHLIVVPSSVMLN 1012
            .|||||||||||||||.|:|||||||||||||||||||:|||||||.|||||||||:||:|||||
  Rat   625 QLREYQHIGLDWLVTMYEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLN 689

  Fly  1013 WEMEFKKWCPGFKILTYYGSQKERKLKRVGWTKPNAFHVCITSYKLVVQDQQSFRRKKWKYLILD 1077
            ||||.|:|||.||||||||:||||||||.||||||||||||||||||:||.|:||||.|:|||||
  Rat   690 WEMELKRWCPSFKILTYYGAQKERKLKRQGWTKPNAFHVCITSYKLVLQDHQAFRRKNWRYLILD 754

  Fly  1078 EAQNIKNFKSQRWQLLLNFSTERRLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEWFSNPM 1142
            ||||||||||||||.||||:::||||||||||||.|||||||||||||:||.||||||||||||:
  Rat   755 EAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNPL 819

  Fly  1143 TGMIEGNMEYNETLITRLHKVIRPFLLRRLKKEVEKQMPKKYEHVITCRLSNRQRYLYEDFMSRA 1207
            ||||||:.||||.|:.|||||:|||||||:|.:|||||||||||||.||||.|||.||:|||::.
  Rat   820 TGMIEGSQEYNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIRCRLSKRQRCLYDDFMAQT 884

  Fly  1208 KTRETLQTGNLLSVINVLMQLRKVCNHPNMFEARPTISPFQMDGITFHTPRLVCDIMEYDPFTQI 1272
            .|:|||.||:.:||||:||||||||||||:|:.||..|||...||.|.|..||....|..|..||
  Rat   885 TTKETLATGHFMSVINILMQLRKVCNHPNLFDPRPVTSPFITPGICFSTASLVLRATEVHPLQQI 949

  Fly  1273 NLETLNLLLLHLEQTMTAYVSH----KSRLLAPPRKLIEDIDTAPLPAPR--------------C 1319
            ::...:  |:.||..::.|.:.    :.||   .|:::.:|.|||.|.||              .
  Rat   950 DMGRFD--LIGLEGRVSRYEADTFLPRHRL---SRRILLEIATAPDPPPRPKPVKMKVNRMLQPV 1009

  Fly  1320 PNGKYRFHIRVRS---------------AELAQRIKLNAV--------KVGASPAMRLEGSKIMP 1361
            |..:.|..:.|.|               .|::.:..|..|        .|.||||    |:.::|
  Rat  1010 PKQEGRTVVVVNSPRAPLGPVPVRPPPGPEVSTQPTLGPVPPVLPTPLMVSASPA----GTPVVP 1070

  Fly  1362 ----------------------------------------------------------------- 1361
                                                                             
  Rat  1071 ASRPPGPVLLSPLQPNTGPLPQVLPSPMGVMSGTSRPPTPTLSLKPAPPAPVRLSPAPPPGSSSL 1135

  Fly  1362 -----------------------------------------------MRNLLPSGRV-------- 1371
                                                           |:..||||.|        
  Rat  1136 LKPLTVPPGYTLSPVAATTTSSTIATVTTTAVPAPNSTPQRLILSPEMQARLPSGEVVSIGQLAS 1200

  Fly  1372 -----------------------------------------LKR-----VSAS------INPVNM 1384
                                                     |:|     |||.      ..|.::
  Rat  1201 LAQRPVTSAGGSKPLTFQIQGNKLTLTGAQVRQLAVGQPRPLQRNVVHLVSAGGQHHLISQPAHV 1265

  Fly  1385 AL----------KPV-VINSVVTTTSSSTTASSP-------------TGALSV------------ 1413
            ||          .|| |:.|..:||.:.|..|.|             ||.:.:            
  Rat  1266 ALIQAVAPTPGPTPVSVLPSTPSTTPAPTGLSLPLAANQVPPSMVNNTGVVKIVVRQAPRDGLTP 1330

  Fly  1414 ------------------------LSNSKL----LG-ARSQINAPT------------------- 1430
                                    |:.|:|    || .|:.|..||                   
  Rat  1331 VPPLAPAPRPSSSGLPAVLTPRPTLTPSRLTSPTLGTTRTPIPTPTLVRPLLKLVHSPSPEVSAS 1395

  Fly  1431 ---------------------PAKVAKTMQDGKPFF----------------------------- 1445
                                 ||..:.|:.:..|..                             
  Rat  1396 APGAAPMTISSSLHMPSSLPGPASSSMTIHNSSPLSSPVVSSTVSVPVSSSLPISVPTTLPVPAS 1460

  Fly  1446 -----------------------------------------------------------YLTPAT 1451
                                                                       .|:|..
  Rat  1461 APLTIPITAPLPVSDLGPALLTGVTPALAVVSAASGPPLASAGVSPSVSALALGLATTPALSPPQ 1525

  Fly  1452 NSG------------------------------------------AAGARLTL------------ 1462
            .||                                          :|.|:.:|            
  Rat  1526 TSGHSLLLATTSSHVPGLNSAVAPACSPVLVPASALTSPFPISPSSAPAQASLLAPAPSTSQALA 1590

  Fly  1463 TSKTTASASTTT-------------------------------------SRTTVTAST-----TS 1485
            ||....:||.||                                     |.|.|:|.|     :|
  Rat  1591 TSLAPMAASQTTILGPSPTPPLAPLPVLAASQTPLPAMTPPSMSGAPLPSSTLVSAPTSVLAPSS 1655

  Fly  1486 GQQLIRDPIVKDLA-------------------------TH------------------------ 1501
            .|.|:..|:...|:                         ||                        
  Rat  1656 TQTLVSTPVSSPLSSLASTQTLTLAPTLAPTLGGLSPSQTHSLGTGSPQGPFPIQTLSLTPASSL 1720

  Fly  1502 VKSTVQKQSIANG---------------------------------------------------- 1514
            |.:..|..|:|.|                                                    
  Rat  1721 VPTPAQTLSLAPGGPVGPTQTLSLAPSSPVGPAPAHTLTLAPAASSASLLVPTSVQTLTLSPAPV 1785

  Fly  1515 --------------------------------------------------KTEPEEET------- 1522
                                                              |.|||..|       
  Rat  1786 PVPTLDPSATQTLALAPALTQAPASQASSLVSASGAASLPVTMVNRLPVPKDEPETLTLRSGPPS 1850

  Fly  1523 -------------------EAEDPYKVQELIQMRKEQRLAALKRMAMINRRRTDATPIYGEDCRE 1568
                               ....|:.:..|.:.||:||...|:|:..::.......|:||   .|
  Rat  1851 PLPTATSFSGPRPRRQPPPPPRSPFYLDSLEEKRKQQRSERLERIFQLSEAHGALAPVYG---TE 1912

  Fly  1569 AIQRCMQATRSLKRSTWQTRGYANCCTAMAHRNGWSLN---HLLKSF-EERCADLKPVFANFVIY 1629
            .:..|     :|.:......|..:  ...:|...|:..   |....| ::|...|..:...|:..
  Rat  1913 VLDFC-----TLPQPVASPIGPRS--PGPSHPIFWTYTEAAHQAVLFPQQRLDQLSEIIERFIFV 1970

  Fly  1630 VPSVCAPRIRRYVQNLSSTH---W--QHEQRIENIVDQALRPKLALLHPIISEMTTKFPDPRLIQ 1689
            :|.|.||     ..:|.:.|   |  .|:...:..:...|.|:...||.|:..|.|:|||.||||
  Rat  1971 MPPVEAP-----PPSLHACHPPPWLAPHQAAFQEQLACELWPRARPLHRIVCNMRTQFPDLRLIQ 2030

  Fly  1690 YDCGKLQTMDRLLRQLKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILMER 1754
            ||||||||:..||||||..|||||||||||:||||||.||.||||:||||||||||||||.||||
  Rat  2031 YDCGKLQTLAVLLRQLKAEGHRVLIFTQMTRMLDVLEQFLTYHGHLYLRLDGSTRVEQRQALMER 2095

  Fly  1755 FNGDKRIFCFILSTRSGGVGINLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLVSE 1819
            ||.|||||||||||||||||:||||||||:||||||||||||||||||||||||||||||||:||
  Rat  2096 FNADKRIFCFILSTRSGGVGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISE 2160

  Fly  1820 RTIEVNILKKANQKRMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSEQDESSQEKSENKDRIVAT 1884
            ||:|.||||||||||||.|||||||||||.|||..||::||.|...|...||             
  Rat  2161 RTVEENILKKANQKRMLGDMAIEGGNFTTAYFKQQTIRELFDMPLEEPPGSS------------- 2212

  Fly  1885 TTLSDTPSTVVET--EKQSLRAFEHALAAAEDEQDVQATKTAKAEVAADLAEFDEN--IPIATED 1945
              :|..|....||  .||: ...|.||..||||:|::|...||||..|:||||:||  .|....:
  Rat  2213 --VSSVPEEEEETVASKQT-HILEQALCRAEDEEDIRAATQAKAEQVAELAEFNENEGFPAGEGE 2274

  Fly  1946 PNAEGGP---QVELSKADLEMQNLVKQLSPIERYAMRFVEETGAAWTAEQLRAAEAELEAQKREW 2007
            ..:..||   ..|:|:|:.|:..||:||:|||||||:|:|.:....:.|:|:.||.::||.:::.
  Rat  2275 EASRPGPGAEDEEMSRAEQEIAALVEQLTPIERYAMKFLEASLEEVSREELKQAEEQVEAARKDL 2339

  Fly  2008 -----EANRL-------------------AAMHKEEELLKQE----TEAEEMLTYSRKD------ 2038
                 |..||                   ...|:..:.:|..    |...|.|..:|.:      
  Rat  2340 DQAKEEVFRLPQEEEEGPGAGDEMSCATSGVSHRRSKKVKAPERLGTRVSERLRGARAETQGANH 2404

  Fly  2039 ----SSNQVWISRNTMEQMPMWC----------------------------------PPTPPQDN 2065
                ||:|   :.||.  :|..|                                  ||.||   
  Rat  2405 TPVTSSHQ---TCNTF--VPPRCSPVRERIPRPRPAPPPAPPAPPPAASPAPAPAPAPPAPP--- 2461

  Fly  2066 DNDIYIDYSLSFMYELEPIAETDLPPVYVRKEHKRSRTDAGYDGSRRPNKMRREDNYVPPRSLFD 2130
                            .|:....|||                               |||    .
  Rat  2462 ----------------PPVLPPVLPP-------------------------------VPP----P 2475

  Fly  2131 RPTPQLARLRRELKSQRFRGSFKPNMPIPGLKPQLPTKPLTEPEAMAEWCVFEDMAI-------- 2187
            .|.|                  .|..|.|...|..|...:....|.|   :...:|.        
  Rat  2476 PPAP------------------SPPAPSPAPPPPAPAASVASAPASA---ITSSLATAPIPISAP 2519

  Fly  2188 -------LHVLVN----LQGLPCSLMLLSPGQTPNWDLVSEMVNFCSKTYRSARQCRWRYETHIQ 2241
                   :|:|.:    ||..|||    ||..||                               
  Rat  2520 NPVTILPVHILPSPAPLLQLPPCS----SPASTP------------------------------- 2549

  Fly  2242 PREEGKVVESPKKQKKLKPT---------LRTEYLKSPLRYL------RTTQLYVSDNNASFYKT 2291
                      |.....| ||         |.|....:||..|      ..|.|.:..........
  Rat  2550 ----------PSACTPL-PTCTPLPAQTSLLTSSSPAPLDSLPVPISPGVTNLLLDSGEVEVCTQ 2603

  Fly  2292 MRSRFDSIKTAYLKKAPPPKRQFSAPSLMNPKHMEVLQEFGILNYDQPVSPQNIAAMKANKIREK 2356
            ..:..:|::...:..:.........|:.:.|..::||.|   ...:.|:.|...:.::|..|.:.
  Rat  2604 ELAPVESLELPGMTNSEASLVSLVPPNDLLPVAVDVLPE---SEKNLPLIPAPSSTLEAESIPDD 2665

  Fly  2357 Q--------RGQQMSQPPVGVGVVQQMQQQSQQQQQPAPPPLPQQQQPQQVVQQVQQQQQQQQQQ 2413
            |        .|...:..|.|..:...:.:.:..:.    ||.....:|.|:              
  Rat  2666 QEQEVPGSVEGTNRTLLPGGGELTVSLSESNGLEL----PPSAASDEPLQL-------------- 2712

  Fly  2414 QQQQVVQQQLPTVSNVQQTLPVQQTV-------ELVQQQPT--TTTTVAVPAAGGQLQQLQIQHL 2469
                     |.|..|::.|..||..|       |||:.:.|  :|::.|..:..|.|.....:..
  Rat  2713 ---------LETHRNLEDTREVQTPVSNSEKPQELVRAEVTAPSTSSSATSSPEGPLPARPPRRR 2768

  Fly  2470 TSSNVS---------------------PGQQTAILLHQPQQQLRTHPGQGGQSNTQQLVKTIVGT 2513
            ||::|.                     ||:...::..:...:.|.|     ::....||..:...
  Rat  2769 TSADVEIRGQGSGRTGQPPGPKVLRKLPGRLVTVVEEKELVKRRRH-----RATASTLVPGVSEV 2828

  Fly  2514 SSSLTAGQLQQLA-QQSAVASGG--QSSVSVVLTTPVQ-----------TLPSVVQPQIGSGAQI 2564
            |:|..:..:..:: .:|:..|.|  :::.:..|:||.|           .:.....|:.|.||::
  Rat  2829 SASPRSPSIHSMSGPESSPPSSGPCEAAPTSSLSTPTQHTFIACRHNELGITGGGSPENGEGAKL 2893

  Fly  2565 VSISSQTLPV-----------NSSP-QLGSIVQTQSLPQVVS------VSTLPTVGTVLTTTANQ 2611
                :.|.|.           |.|| ..|..|  ...|..:|      |..:|...|| |.||.:
  Rat  2894 ----AITPPAVKRRRGRPPKKNRSPADAGRGV--DEAPSSISKGKTNGVDPIPGPETV-TATAAE 2951

  Fly  2612 PQQQHQTTAVTTLNTTMLRGQRIVSTAAGNTLQQRTTAGGQ----SIVSMP---NLGQGASPSQF 2669
            |..:.|..|...::    :.:.|:.:......:.|......    ..:|.|   ||.....|..|
  Rat  2952 PDLKPQPLAPQPVH----KPEPIILSPVEKRRRGRPPKARDLPIPGTISSPGDGNLESRTQPLPF 3012

  Fly  2670 QTQLR-LAAVPTSPATQTTQLVTTKGIPVSALQQGGKTTVIPVTQQSGGAHIQLYRQRSLKVLQT 2733
            ...|. |.|.||:.|...|.:..:...|.....:..|....|...|    |..|....| .||::
  Rat  3013 PATLTPLLACPTAVANTVTTVTISTSPPKRKRGRPPKNPPSPRPSQ----HPVLDPDSS-SVLES 3072

  Fly  2734 T---TQAVPSGSAGATGATANLVQAGGTIIQASNMATHVTSQKVAVSGMPGTSTTVQAGNVVSSV 2795
            .   .|..|.|.|.:.|::::        ...|...|.:...::...||.|..:   .|::|.:|
  Rat  3073 CGLGVQRQPLGQAESEGSSSD--------EDGSRPLTRLARLRLEAEGMRGRKS---EGSMVMAV 3126

  Fly  2796  2795
              Rat  3127  3126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
domNP_001286676.1 HSA 543..614 CDD:214727 35/71 (49%)
ASF1_hist_chap <674..831 CDD:304562 62/216 (29%)
FAM176 <824..>868 CDD:291517 13/72 (18%)
SNF2_N 952..1238 CDD:278600 238/286 (83%)
DEXDc 969..1108 CDD:238005 121/139 (87%)
Helicase_C 1692..1806 CDD:278689 101/114 (89%)
SrcapXP_017445721.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0391
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188211at2759
OrthoFinder 1 1.000 FOG0000933
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45685
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.