DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ogre and inx-10

Sequence 1:NP_001245557.1 Gene:ogre FlyBaseID:FBgn0004646 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001024139.1 Gene:inx-10 WormBaseID:WBGene00002132 Length:559 Species:Caenorhabditis elegans

Alignment Length:327 Identity:84/328 (26%)
Similarity:143/328 (44%) Gaps:74/328 (23%)


  Fly     4 LLGSLKSYLKWQDIQTD-NAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPHVVNT- 66
            :|.::.|.|::.....| :.|.|||:.||..||:..:::::..|:.|:|:.|:|    |.:.:: 
 Worm     2 VLAAVLSMLRYVGGSDDRDFVDRLHSYFTCNLLIGLAVLVSFKQFGGKPVECLV----PDIFSSS 62

  Fly    67 -------FCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACY 124
                   :||...|:.:|           .:..||....||..::..:|||||.|.|..:| ||:
 Worm    63 WEQYAENYCWASDTYYVP-----------TNEPVAGLQSDEKRQRKISYYQWVPFFLLLEA-ACF 115

  Fly   125 -TPKFLWNKFEGGLMRMIVMGLNITICTR----------EEKEAKRDALLDYL-----------I 167
             .|..||....|.      .|:.|....:          :.|.|...:|..:|           .
 Worm   116 RLPSLLWKYLAGH------SGIKINEIVKLSSDPNNIKPDIKRANIKSLTVHLQGALRFHRRLQK 174

  Fly   168 KHVKRHKL-------YAIRYWACEFLC-----CINIIVQMYLMNRFFDGE---FLSYGTNIMKLS 217
            |.::.|:.       |:..:....:||     ..|:.:|:..||||.:.:   :...|..:..|:
 Worm   175 KQIRPHRFLWLFNLPYSAFFVTAMYLCTKFFYLANVCLQLMFMNRFLETDKYKWYGMGALVDLLN 239

  Fly   218 DVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWILLVLL 282
            ....||.     .:||||:.|.| .....|::|:|...|:|.:||.|||.::.:|||:..|||..
 Worm   240 GTTWEQS-----GMFPRVSLCDF-DVRVMGNMQEHTIQCVLVINIFNEKIFILLWFWYLALLVFT 298

  Fly   283 IG 284
            .|
 Worm   299 FG 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ogreNP_001245557.1 Innexin 20..351 CDD:279248 81/312 (26%)
inx-10NP_001024139.1 Innexin 20..380 CDD:279248 80/310 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
OrthoInspector 1 1.000 T97983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11893
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.