DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ogre and inx-5

Sequence 1:NP_001245557.1 Gene:ogre FlyBaseID:FBgn0004646 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_509403.2 Gene:inx-5 WormBaseID:WBGene00002127 Length:447 Species:Caenorhabditis elegans

Alignment Length:387 Identity:94/388 (24%)
Similarity:149/388 (38%) Gaps:89/388 (23%)


  Fly     4 LLGSLKSYL-KWQ-DIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPH---- 62
            ::|.|..|: |:| ..::::...|....:|:.||...::::.|:||||:||.|   .||..    
 Worm     1 MIGVLLPYVRKFQRSAESNDIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQC---WVPAQFTRT 62

  Fly    63 ---VVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACY 124
               ...|:|:|..|:.:|.||..:....|..|..|     ..|.....||||:..||..||...|
 Worm    63 WEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDA-----VTATPQVGYYQWIPIVLVLQAFLFY 122

  Fly   125 TPKFLWNKFEGGLMRMIVMGLNITICTREEK------EAKRDALLDYLIKH-------------- 169
            .|..:|..|.......|.....::..:|:.|      :.|......|..|.              
 Worm   123 LPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDDQVKATKFGRYFFKKLNFRNESPVFKETG 187

  Fly   170 --VKRHKLYAIRYWACEFLCCINIIVQMYLMNRFFDGEFLSYGTNIMKLSDVPQEQRVDPMVYVF 232
              |...|.....|...:.|...||::|.:::..|.:.:...:|....:.....:|...   ..:|
 Worm   188 SVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWET---TGIF 249

  Fly   233 PRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWILLVLLIGLIVFRGCIIFMPK 297
            ||||.|.|.....: |:..|...|::.:|::.||.|||.|||     :|.:||:.          
 Worm   250 PRVTMCDFSIMDLT-SVHDHSIQCVIVINMLAEKVYVFFWFW-----LLFVGLLT---------- 298

  Fly   298 FRPRLLNASNRMIPMEICRSLSRKLDIGDWWLIYML---GRNLDPVIYKDVMS--EFAKQVE 354
                            :|       .:..|.:||||   |||.   ||..:..  ||..:.|
 Worm   299 ----------------VC-------SLAYWAVIYMLQSVGRNF---IYSYLQQTPEFQTEQE 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ogreNP_001245557.1 Innexin 20..351 CDD:279248 88/365 (24%)
inx-5NP_509403.2 Innexin 20..379 CDD:279248 89/369 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
OrthoInspector 1 1.000 T97983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11893
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.