DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ogre and inx-17

Sequence 1:NP_001245557.1 Gene:ogre FlyBaseID:FBgn0004646 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_491315.1 Gene:inx-17 WormBaseID:WBGene00002139 Length:362 Species:Caenorhabditis elegans

Alignment Length:369 Identity:96/370 (26%)
Similarity:159/370 (43%) Gaps:69/370 (19%)


  Fly    21 NAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIV----NGVPPHVVNTFCWIHSTFTMPDAFR 81
            :|:.||...||..||.:.:..|.|.|||||.|.|..    .|.......::|.|.:|:     :.
 Worm    19 DAIDRLRYYFTVFLLTSSAFFIMAKQYVGQSIQCWAPKQFKGGWEEYAESYCLIENTY-----YV 78

  Fly    82 RQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLN 146
            ......:..|.:..:       |...|||||.|:||..|:..|.|:.:||..:.      ::|:|
 Worm    79 HMNNSNLPGPAIREN-------KELKYYQWVPFILFGLAVVIYIPRVIWNALQS------LIGIN 130

  Fly   147 ITICTREEKEAKRDAL------LDYLIKHVKRHKLYAIR-----YW---------ACEFLCCINI 191
            |:|.|...::..:...      ::...|.::..|....|     :|         |.:||..|.|
 Worm   131 ISIVTSNLRKVAKSGFTSENPDIEKKKKEMQCKKKATSRQVDGEFWGSRLTTCILATKFLATILI 195

  Fly   192 IVQMYLMNRFFDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFH----KYGPSGSLQKH 252
            .:.|..:: :|.|....||..|.|  |:.|.::.... ..|||||.|.|.    .|..:.|||  
 Worm   196 FISMGFLD-YFMGLGPMYGWTITK--DILQGRQWQES-GSFPRVTFCDFQVRELGYVNNWSLQ-- 254

  Fly   253 DSLCILPLNIVNEKTYVFIWFWFWILLVLL---IGLIVFRGCIIFMPKFRPRLLNASNRMIPMEI 314
               |:|.:|:.|||.::.:|:|:.:|.:|.   |..::||..|.....|..|:|..:.       
 Worm   255 ---CVLMVNMFNEKLFIALWWWYALLAILSIFDIFRVLFRFTIHHQISFITRILACTG------- 309

  Fly   315 CRSLSRKLDIGDW--WLIYMLGRNLDPVIYKD-VMSEFAKQVEP 355
             .|.....::|::  .::.:.|.||..::|.: .:.|.|..|.|
 Worm   310 -DSAISATEVGEFNRKVLRIDGINLTHLVYANATIFEAADFVRP 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ogreNP_001245557.1 Innexin 20..351 CDD:279248 94/364 (26%)
inx-17NP_491315.1 Innexin 19..357 CDD:279248 96/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3116
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D323554at33208
OrthoFinder 1 1.000 FOG0000263
OrthoInspector 1 1.000 T97983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11893
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.