DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and AT1G20810

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_173504.1 Gene:AT1G20810 / 838672 AraportID:AT1G20810 Length:232 Species:Arabidopsis thaliana


Alignment Length:178 Identity:40/178 - (22%)
Similarity:73/178 - (41%) Gaps:38/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 AVSSLNYCRMANDEEERKQTELLTTLNQ-------NLMIVYNKMNKPKRACIMMKALRHLT---- 297
            ::|||:  |.|:::..|  ...:|::::       |.::.::.....:.|.|::.:...||    
plant     3 SISSLH--RWASNQHSR--LPRITSISEADQSRPINQVVAFSVPISRRDASIILLSSIPLTSFFV 63

  Fly   298 MGNPSCKALFQEGRALAALGEYNLARNA---YLQAQAKQPANKEISD----------EIISMNKR 349
            :...|.:|..:..|.:..|.||:.....   |...:.|.|...|.|.          .|.:::.|
plant    64 LTPSSSEARERRSRKVIPLEEYSTGPEGLKFYDIEEGKGPVATEGSTAQVHFDCRYRSITAISTR 128

  Fly   350 ISKYEEASRDIWARAFSLKNSKSDVRKTPAQLEKEAKEQDFNDKMEDL 397
            .||....:|.| |:.:..|     |..||.   ||.| ::|.|....|
plant   129 ESKLLAGNRSI-AQPYEFK-----VGSTPG---KERK-REFVDNPNGL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735
TPR repeat 218..257 CDD:276809 5/12 (42%)
TPR 230..>389 CDD:440225 37/168 (22%)
TPR repeat 262..295 CDD:276809 4/39 (10%)
TPR repeat 304..329 CDD:276809 6/27 (22%)
AT1G20810NP_173504.1 FKBP_C 105..223 CDD:459735 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.