DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and AT5G13410

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_196845.1 Gene:AT5G13410 / 831182 AraportID:AT5G13410 Length:256 Species:Arabidopsis thaliana


Alignment Length:117 Identity:26/117 - (22%)
Similarity:41/117 - (35%) Gaps:33/117 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLL 166
            ||.:     .|.:||:...|         |.|..|...|:...|.||..|........|:.    
plant   158 NKTK-----GGSFEGDDKEF---------FKFTLGSNEVIPAFEEAVSGMALGGIRRIIVP---- 204

  Fly   167 FGELGCPPRIKPKA-------------DALFKVE-VIDYSLIGDAKGIDAIP 204
             .|||.|.....|:             |.:.:.: :||.:|:.|.:.:..:|
plant   205 -PELGYPDNDYNKSGPRPMTFSGQRALDFVLRNQGLIDKTLLFDVELLKIVP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 21/100 (21%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
AT5G13410NP_196845.1 FkpA 119..253 CDD:440311 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.