DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and AT4G19830

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_193718.1 Gene:AT4G19830 / 827727 AraportID:AT4G19830 Length:229 Species:Arabidopsis thaliana


Alignment Length:68 Identity:18/68 - (26%)
Similarity:26/68 - (38%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 FAPSNFLDRQVSTTLQPLKDYVYTQNCAALITNTNPLRSNLNEYILRVQQSGLLYH---LGIRTA 550
            ||.:|.:.||......|   |.|....|..|.::...|..||.....:......||   .|.:.:
plant    37 FASTNVISRQEPPQKPP---YSYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNS 98

  Fly   551 IRY 553
            ||:
plant    99 IRH 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
AT4G19830NP_193718.1 FkpA 93..223 CDD:440311 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.