DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and AT3G12340

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_187840.7 Gene:AT3G12340 / 820412 AraportID:AT3G12340 Length:499 Species:Arabidopsis thaliana


Alignment Length:205 Identity:51/205 - (24%)
Similarity:79/205 - (38%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PQLLKNPLSYSDLVKKGVEFEVD-NSQQNHARDLGLDSDSDSDYEDALDV-DGEELRSPWTYSFD 72
            |:.|:|....||   ||::...| ...||....|..........|:..|| :..|.:.       
plant   313 PESLQNENPVSD---KGIKSSSDVLLSQNGDATLSKKKKKRDRREETTDVPECPEKKK------- 367

  Fly    73 ELRALMSEIDENIYKRI-------TRT------------GHVDREAVPNKARVSVRYSGYWEGET 118
                  ..||:||.|..       |||            |.:|.::.....:||:.|:|..:...
plant   368 ------QAIDKNIEKEAGTKKPLETRTLSNGVIIEDIEKGKLDGKSAVKGKKVSILYTGKLKDTG 426

  Fly   119 APFDSSL----LRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPK 179
            ..|||:|    ||     |..|...|:|||.:.|..||..::...||...|.:.:.|...::...
plant   427 NLFDSNLGEDPLR-----FRLGGENVIEGLSIGVEGMRVGDKRRLIIPPALGYSKRGLKEKVPKS 486

  Fly   180 ADALFKVEVI 189
            |..:::||.:
plant   487 AWLVYEVEAV 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 27/96 (28%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
AT3G12340NP_187840.7 NPL 3..96 CDD:465511
FkpA 393..498 CDD:440311 28/109 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.