DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and FKBP7

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_851939.1 Gene:FKBP7 / 51661 HGNCID:3723 Length:222 Species:Homo sapiens


Alignment Length:131 Identity:32/131 - (24%)
Similarity:58/131 - (44%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 VSVRYSGYWEGETAPFDSSLLRGSKFV------------FETGQGTVVEGLEVAVRSMRPYEQAE 158
            ::..|.||...:          ||||.            |..|.|.|::||::|:..|.|.|:.:
Human    56 LNAHYDGYLAKD----------GSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRK 110

  Fly   159 FIISYKLLFGELG-CPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLH 222
            .:|.....:|:.| ...:|.|.|..:|::|:  |::....:.|:...|.|.|....:....::|:
Human   111 VVIPPSFAYGKEGYAEGKIPPDATLIFEIEL--YAVTKGPRSIETFKQIDMDNDRQLSKAEINLY 173

  Fly   223 L 223
            |
Human   174 L 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 25/95 (26%)
TPR repeat 218..257 CDD:276809 2/6 (33%)
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
FKBP7NP_851939.1 FKBP_C 46..141 CDD:459735 24/94 (26%)
FRQ1 <127..213 CDD:444056 12/50 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222
Retention in the endoplasmic reticulum. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 219..222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.