DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and FKBP11

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_047284895.1 Gene:FKBP11 / 51303 HGNCID:18624 Length:282 Species:Homo sapiens


Alignment Length:68 Identity:25/68 - (36%)
Similarity:35/68 - (51%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKV 186
            |:||.| ...|.|.||..|:.|||.::..|...|:...||...|.:|:.|.||.:...|...:.|
Human   156 DTSLTR-DPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDV 219

  Fly   187 EVI 189
            |:|
Human   220 ELI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 24/66 (36%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
FKBP11XP_047284895.1 FKBP_C 147..222 CDD:459735 24/66 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.