DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp14

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster


Alignment Length:161 Identity:47/161 - (29%)
Similarity:77/161 - (47%) Gaps:15/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ENIYKRITRTGHVDREAVPNKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVA 147
            :::...:..|..|..:...|...:::.|:|..:.:...||||..|...|.|:.|.|.|::|.:..
  Fly    24 QDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADGKKFDSSFDRDQPFTFQLGAGQVIKGWDQG 88

  Fly   148 VRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVEVIDYSLIGDA-------KGID--AI 203
            :.:|...|:.:..|..:|.:|:.|....|.|||..||.||:|:   ||:|       |.||  |.
  Fly    89 LLNMCVGEKRKLTIPPQLGYGDQGAGNVIPPKATLLFDVELIN---IGNAPPTTNVFKEIDDNAD 150

  Fly   204 PQEDRDKFCVV---YPKAVDLHLHGKDSVKL 231
            .|..|::..|.   |.|.....:.|:||.:|
  Fly   151 KQLSREEVIVYVSEYLKKQMTAVEGQDSEEL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 28/92 (30%)
TPR repeat 218..257 CDD:276809 4/14 (29%)
TPR 230..>389 CDD:440225 1/2 (50%)
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:459735 28/92 (30%)
FRQ1 <142..212 CDD:444056 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.