DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp12

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:88 Identity:29/88 - (32%)
Similarity:44/88 - (50%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLL 166
            |..:|:|.|:|..:..| .||||..|...|.|..|:|.|:.|.:..|..:...::|:.|.|....
  Fly    19 NGQKVTVHYTGTLDDGT-KFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYA 82

  Fly   167 FGELGCPPRIKPKADALFKVEVI 189
            :|..|.|..|.|.:...|.||::
  Fly    83 YGSRGHPGVIPPNSTLTFDVELL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 29/86 (34%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 29/88 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.