DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp3

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_038930.1 Gene:Fkbp3 / 30795 MGIID:1353460 Length:224 Species:Mus musculus


Alignment Length:189 Identity:49/189 - (25%)
Similarity:74/189 - (39%) Gaps:44/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SYSDLVK----KGVEFEVDNSQQNHARDLGLDSDSDSDYEDALDVDGEELRSPWTYSFDELRALM 78
            :|:.|.:    ||.|.....|:|.....|..|...||..|:.||      ..|..|:        
Mouse    62 AYNHLFESKRFKGTETISKVSEQVKNVKLSDDKPKDSKSEETLD------EGPPKYT-------- 112

  Fly    79 SEIDENIYKRITRTGHVDREAVPNKARVSVRYSGYWEGETAP----FDSSLLRGSK-------FV 132
                    |.|.:.|  |:...|.|..|    ...|...|.|    ||:::...||       ..
Mouse   113 --------KSILKKG--DKTNFPKKGDV----VHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLS 163

  Fly   133 FETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCP-PRIKPKADALFKVEVID 190
            |:.|.|.|:.|.:.|:.:|...|:|...|..:..:|:.|.| .:|.|....:|:||::|
Mouse   164 FKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 29/104 (28%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp3NP_038930.1 BTHB_FKBP25 7..73 CDD:439139 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..118 11/51 (22%)
FKBP_C 124..221 CDD:459735 28/100 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.