DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp1a

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_037234.2 Gene:Fkbp1a / 25639 RGDID:2617 Length:108 Species:Rattus norvegicus


Alignment Length:95 Identity:32/95 - (33%)
Similarity:45/95 - (47%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DREAVPNKARVS-VRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEF 159
            |....|.:.:.. |.|:|..| :...||||..|...|.|..|:..|:.|.|..|..|...::|:.
  Rat    12 DGRTFPKRGQTCVVHYTGMLE-DGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKL 75

  Fly   160 IISYKLLFGELGCPPRIKPKADALFKVEVI 189
            |||....:|..|.|..|.|.|..:|.||::
  Rat    76 IISPDYAYGATGHPGIIPPHATLVFDVELL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 32/93 (34%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp1aNP_037234.2 FkpA 3..106 CDD:440311 32/95 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.