DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and ani1

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_596694.1 Gene:ani1 / 2539812 PomBaseID:SPBC1347.02 Length:361 Species:Schizosaccharomyces pombe


Alignment Length:88 Identity:24/88 - (27%)
Similarity:42/88 - (47%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLL 166
            |..:|.:||.|..|.... ||.: .:|..|.|..|:|.|:.|.:|.|..|:...:.:..|...:.
pombe   274 NGKKVEMRYIGKLENGKV-FDKN-TKGKPFAFILGRGEVIRGWDVGVAGMQEGGERKITIPAPMA 336

  Fly   167 FGELGCPPRIKPKADALFKVEVI 189
            :|.... |.|...:..:|:|:::
pombe   337 YGNQSI-PGIPKNSTLVFEVKLV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 24/86 (28%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
ani1NP_596694.1 NPL 7..121 CDD:465511
FkpA 259..360 CDD:440311 24/88 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.