DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and fkb-4

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_506197.1 Gene:fkb-4 / 179752 WormBaseID:WBGene00001429 Length:259 Species:Caenorhabditis elegans


Alignment Length:65 Identity:20/65 - (30%)
Similarity:33/65 - (50%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKV 186
            |||..|.:.|||......|::|:::|:..|...|:...:|..:..:|..|.||.|...|...|::
 Worm   184 DSSYSRNAPFVFRLRNREVIDGMDIAMDGMCEGERRRVVIPSEYGYGSQGSPPEIPGGARLFFEI 248

  Fly   187  186
             Worm   249  248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 20/65 (31%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
fkb-4NP_506197.1 FKBP_C 45..130 CDD:459735
FKBP_C 161..250 CDD:459735 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.