DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp7

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_034352.1 Gene:Fkbp7 / 14231 MGIID:1336879 Length:218 Species:Mus musculus


Alignment Length:199 Identity:47/199 - (23%)
Similarity:77/199 - (38%) Gaps:53/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DSDSDSDYEDALDVDGEELRSPWTYSFDELRALMSEIDENIYKRITRTGHVDREAVPNKARVSVR 109
            |:...:..|...:|..|.|..|                ||..| .:|.|.:          ::..
Mouse    18 DAQGQTKEESTEEVKIEVLHRP----------------ENCSK-TSRKGDL----------LNAH 55

  Fly   110 YSGYWEGETAPFDSSLLRGSKFV------------FETGQGTVVEGLEVAVRSMRPYEQAEFIIS 162
            |.||...:          ||||.            |..|.|.|::||::|:..|.|.|:.:.||.
Mouse    56 YDGYLAKD----------GSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIP 110

  Fly   163 YKLLFGELG-CPPRIKPKADALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLHLHGK 226
            ....:|:.| ...:|.|.|..:|::|:  |::....:.|:...|.|.|....:....::|:|. |
Mouse   111 PSFAYGKEGYAEGKIPPNATLMFEIEL--YAVTKGPRSIETFKQIDTDNDRQLSKAEIELYLQ-K 172

  Fly   227 DSVK 230
            |..|
Mouse   173 DFEK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 26/105 (25%)
TPR repeat 218..257 CDD:276809 5/13 (38%)
TPR 230..>389 CDD:440225 1/1 (100%)
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp7NP_034352.1 FKBP_C 42..137 CDD:459735 28/115 (24%)
EFh_CREC 147..>213 CDD:330175 9/31 (29%)
EF-hand motif 147..174 CDD:320021 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..218
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 215..218
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.