DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and Fkbp10

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_034351.2 Gene:Fkbp10 / 14230 MGIID:104769 Length:581 Species:Mus musculus


Alignment Length:150 Identity:43/150 - (28%)
Similarity:66/150 - (44%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VPNKARVSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYK 164
            |.|...|...|:|.....|| ||:|..||..:....|.|.:::|::..:..|.|.|:.:.||...
Mouse   170 VQNSDFVRYHYNGTLLDGTA-FDNSYSRGGTYDTYIGSGWLIKGMDQGLLGMCPGEKRKIIIPPF 233

  Fly   165 LLFGELGCPPRIKPKADALFKVEVIDYSLIGDAKGIDA--IPQEDRDKFCVVYPKAVD-LHLHGK 226
            |.:||.|....|.|:|..:|.|.::|.....|...::.  :||.     ||....|.| :..|..
Mouse   234 LAYGEKGYGTVIPPQASLVFYVLLL
DVHNPKDTVQLETLELPQG-----CVRRAVAGDFMRYHYN 293

  Fly   227 DSVKLGRYQSAATAFERAVS 246
            .|:..|      |.|:.:.|
Mouse   294 GSLMDG------TLFDSSYS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 29/88 (33%)
TPR repeat 218..257 CDD:276809 7/29 (24%)
TPR 230..>389 CDD:440225 3/16 (19%)
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Fkbp10NP_034351.2 FKBP_C 54..146 CDD:459735
FKBP_C 166..258 CDD:459735 29/88 (33%)
FKBP_C 278..370 CDD:459735 9/35 (26%)
FKBP_C 391..482 CDD:459735
FRQ1 482..>567 CDD:444056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..581
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 578..581
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.