DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shu and fkbp9

DIOPT Version :10

Sequence 1:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001123385.1 Gene:fkbp9 / 100125793 XenbaseID:XB-GENE-1019523 Length:585 Species:Xenopus tropicalis


Alignment Length:105 Identity:30/105 - (28%)
Similarity:47/105 - (44%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HVDREAVPNKAR--------VSVRYSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRS 150
            |:::..||:..:        |...|.|.:...| .||||..|||.:....|:|.::.|::.|:..
 Frog    50 HIEKRWVPDTCQRHVTEGDFVRYHYHGTFPDGT-KFDSSYDRGSTYNVFVGKGQIIAGMDKALLG 113

  Fly   151 MRPYEQAEFIISYKLLFGELGCPPRIKPKADALFKVEVID 190
            |...|:....|...|.:|..|....|.|.|...|.|.::|
 Frog   114 MCVNERRFVKIPPSLAYGSKGLADVIPPDAVLHFDVLLLD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shuNP_611837.1 FKBP_C 96..189 CDD:459735 28/100 (28%)
TPR repeat 218..257 CDD:276809
TPR 230..>389 CDD:440225
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
fkbp9NP_001123385.1 FKBP_C 60..152 CDD:459735 26/92 (28%)
FKBP_C 172..264 CDD:459735
FKBP_C 284..375 CDD:459735
FKBP_C 395..487 CDD:459735
EFh 510..571 CDD:238008
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.