DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Hand1

DIOPT Version :10

Sequence 1:NP_524820.2 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_067603.1 Gene:Hand1 / 59112 RGDID:621206 Length:216 Species:Rattus norvegicus


Alignment Length:115 Identity:33/115 - (28%)
Similarity:56/115 - (48%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 PISRPHQHQRNYKNM---TRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRV 312
            |.:||.|.....:.:   ...|:.....:||.|..:|::|:..||:.:|...:..||||:..||:
  Rat    74 PDARPSQSPGRLEALGGRLPRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRL 138

  Fly   313 ACSYILTLSRMAGEDYSADQSVPSIATCLEAVTSTI-QTEG--KVKRKKD 359
            |.|||..|..:..:|..|...        ||..:.: :|:|  :.|||::
  Rat   139 ATSYIAYLMDVLAKDAQAGDP--------EAFKAELKKTDGGRESKRKRE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_524820.2 bHLH_TS_ATOH8 262..329 CDD:381427 21/69 (30%)
Hand1NP_067603.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..109 8/34 (24%)
bHLH_TS_HAND1 94..153 CDD:381522 20/58 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.