DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and cato

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_477344.1 Gene:cato / 36813 FlyBaseID:FBgn0024249 Length:189 Species:Drosophila melanogaster


Alignment Length:172 Identity:52/172 - (30%)
Similarity:77/172 - (44%) Gaps:41/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 QLEPL--------ALVTTKKQCVDQA-------GPKIEAFSALLIGKQPSAKKTLKERTQKESTS 231
            ||.|:        |.::.:.|.:|.|       ||.:||...   ..||..|:          .|
  Fly    27 QLPPVSGQDYGQGAFLSPEWQFLDAAGGTQTELGPIMEAQGQ---HTQPQTKR----------RS 78

  Fly   232 SSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVP 296
            :||..:........:|.|:|            .:.:.||..||||||.|::.::||:|.||:.||
  Fly    79 NSFTGSDGRKSSPEQTNLSP------------TVQKRRRQAANARERKRMNGLNAAFERLREVVP 131

  Fly   297 AYASTQKLSKLSVLRVACSYILTLSRMAGE-DYSADQSVPSI 337
            |.:..|||||...|::|.||||.|..:... |...|.:..:|
  Fly   132 APSIDQKLSKFETLQMAQSYILALCDLLNNGDVEVDAAAYTI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 28/50 (56%)
catoNP_477344.1 HLH 104..155 CDD:278439 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.