DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and AgaP_AGAP004299

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_562042.3 Gene:AgaP_AGAP004299 / 3291000 VectorBaseID:AGAP004299 Length:407 Species:Anopheles gambiae


Alignment Length:264 Identity:55/264 - (20%)
Similarity:95/264 - (35%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SSASMNATGPLKKRIRYTSSADSAVVLTPPAIDS----PPPNSCIPSTLRLQHEIMPNPAHIYVR 165
            |...|:..||..|.:..|....:|.::....:.|    ........:|.....|:...|...:.|
Mosquito     7 SDIDMSKLGPSAKGLLTTFENANASLMASALVSSIQFVTAAKDVAEATRHSDCEVQSRPEAYFSR 71

  Fly   166 HP----GVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQ 226
            .|    ....:....:...:.||.|.|..:..      ||..|..::   |..|....:|:  |.
Mosquito    72 SPMQDLSDDDMSDFSSNESDGLEELDLKNSGH------GPSAEEETS---GSNPDGCGSLE--TS 125

  Fly   227 KESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETL 291
            ....:.:..:..:....:|.:|..                 .|::.:|.|||.|...:|.|:..|
Mosquito   126 MPVLNLAGTKLGIGSSSINGSGAV-----------------VRKMFSNTRERWRQQNVSGAFAEL 173

  Fly   292 RQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPSIATCL--------EAVTSTI 348
            |:.||.:...:||||..:||:|..||..|:.:.  ::...|....:.|.|        :.:.|..
Mosquito   174 RKLVPTHPPDKKLSKNEILRMAIRYIRLLTNVL--EWQKKQEANDLRTPLKQRSSQQSQQLLSIS 236

  Fly   349 QTEG 352
            ||.|
Mosquito   237 QTTG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
AgaP_AGAP004299XP_562042.3 AFD_class_I <124..>158 CDD:302604 5/50 (10%)
HLH 156..207 CDD:197674 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.