DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and AgaP_AGAP007696

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_564527.3 Gene:AgaP_AGAP007696 / 3290413 VectorBaseID:AGAP007696 Length:149 Species:Anopheles gambiae


Alignment Length:48 Identity:18/48 - (37%)
Similarity:25/48 - (52%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPSIA 338
            ||:.||.....:|||||.|::....||..|.. |.:.:.|..|..|:|
Mosquito    43 LRELVPFMPKNRKLSKLEVIQNVIDYICELQN-ALDSHPAVNSFDSLA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 12/28 (43%)
AgaP_AGAP007696XP_564527.3 HLH 24..76 CDD:238036 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.