DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and HLH4C

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:241 Identity:52/241 - (21%)
Similarity:85/241 - (35%) Gaps:71/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GPPSSASMNATGPLKKRIRYTSSADSAVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHIYVRH 166
            |||.|.|::         ||....|..::         .||               ||..:...:
  Fly    11 GPPQSISLS---------RYYLVDDDEMI---------GPN---------------NPHLVNEDY 42

  Fly   167 PGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTS 231
            ...|||.                      :|:   :.:|..|.....||:.........::.:|.
  Fly    43 AASTTLD----------------------IDK---RFQARMACETAAQPAPPPPPTPAPRRRTTP 82

  Fly   232 SSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVP 296
            .:.|:.|         .|..:||  :.:|..:..|.:.|.....|||.||...:.::..||:.:|
  Fly    83 IAHLDPS---------ELVGLSR--EERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLP 136

  Fly   297 AYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPSIAT-CL 341
            .....:||||:.:|::|..||..|:.:. |.........|.|| ||
  Fly   137 TLPPDKKLSKIEILKLAICYIAYLNHVL-ETPXDSAGASSFATSCL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 17/50 (34%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.