powered by:
Protein Alignment net and Ascl5
DIOPT Version :9
Sequence 1: | NP_001259789.1 |
Gene: | net / 45339 |
FlyBaseID: | FBgn0002931 |
Length: | 360 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257538.1 |
Gene: | Ascl5 / 226439 |
MGIID: | 2685043 |
Length: | 188 |
Species: | Mus musculus |
Alignment Length: | 50 |
Identity: | 19/50 - (38%) |
Similarity: | 27/50 - (54%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 NARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM 323
|.|||.||..::..|..||..:|...:.::|||:..||.|..||..|..:
Mouse 86 NERERQRVKCVNEGYARLRGHLPGALTEKRLSKVETLRAAIRYIKYLQEL 135
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
net | NP_001259789.1 |
HLH |
269..320 |
CDD:278439 |
18/45 (40%) |
Ascl5 | NP_001257538.1 |
HLH |
86..136 |
CDD:197674 |
19/49 (39%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.