DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Lyl1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_032561.2 Gene:Lyl1 / 17095 MGIID:96891 Length:278 Species:Mus musculus


Alignment Length:260 Identity:65/260 - (25%)
Similarity:95/260 - (36%) Gaps:86/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SKSMPGPPSSASMNATGPLKKRIRYTSSADSAVVLTP------PAID---SPPPNSCIPST---- 148
            |...|.|||..:  :.|||.     |...|.....||      |.|:   :.|..:.:|:|    
Mouse    24 SSPAPAPPSKPA--SPGPLS-----TEEVDHRNTCTPWLPPGVPVINLGHTRPIGAAMPTTELSA 81

  Fly   149 -------LRLQHEIMPNPAHIYVRHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGPKIEAF 206
                   |.......|..|..|..||.:.:::                      :..|||    |
Mouse    82 FRPSLLQLTALGRAPPTLAVHYHPHPFLNSVY----------------------IGPAGP----F 120

  Fly   207 SALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRI 271
            |..     |:::  ||.|       .|..|..|:|             .||.|:      ..||:
Mouse   121 SIF-----PNSR--LKRR-------PSHSELDLAD-------------GHQPQK------VARRV 152

  Fly   272 EANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPS 336
            ..|:|||.|...::.|:..||:.:|.:...:||||..|||:|..||..|.|:..:..:...|.||
Mouse   153 FTNSRERWRQQHVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQTAVLTSGPS 217

  Fly   337  336
            Mouse   218  217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
Lyl1NP_032561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 9/28 (32%)
bHLH_TS_LYL1 145..209 CDD:381548 24/69 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..278 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.