Sequence 1: | NP_001259789.1 | Gene: | net / 45339 | FlyBaseID: | FBgn0002931 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001342593.4 | Gene: | tcf23 / 100002924 | ZFINID: | ZDB-GENE-090806-5 | Length: | 277 | Species: | Danio rerio |
Alignment Length: | 219 | Identity: | 58/219 - (26%) |
---|---|---|---|
Similarity: | 86/219 - (39%) | Gaps: | 51/219 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 149 LRLQHEIMPNPAHIYVRHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGPKIEA-------- 205
Fly 206 --FSALLIGKQPS---AKKTLKE--------------RTQKESTSSSFLEASLSDEDLNKTGLAP 251
Fly 252 ISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSY 316
Fly 317 ILTLSR------MAGEDYSADQSV 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
net | NP_001259789.1 | HLH | 269..320 | CDD:278439 | 20/50 (40%) |
tcf23 | XP_001342593.4 | HLH | 170..221 | CDD:197674 | 21/50 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |