DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dib and Cyp12b2

Sequence 1:NP_524810.2 Gene:dib FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:476 Identity:150/477 (31%)
Similarity:219/477 (46%) Gaps:55/477 (12%)


  Fly    18 AKPYQAIPGPRGPFGMGNLYNYLPGIGSYSWLRLHQAGQDKYEKYGAIVRETIVPGQ----DIVW 78
            |:.:..||||.   .:..|..::|| |:.....|.|..:...|.||.|.   .:||.    :.|:
  Fly    50 ARSFGEIPGPS---LLRMLSFFMPG-GALRNTNLIQMNRLMREMYGDIY---CIPGMMGKPNAVF 107

  Fly    79 LYDPKDIALLL-NERDCPQRRSHLALAQYRK-SRPDVYK-TTGLLPTNGPEWWRIRAQVQKELSA 140
            .|:|.|..:.. ||...|.|....:|..||| .||||:| ..||....|.||..||.:|...|..
  Fly   108 TYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMK 172

  Fly   141 PKSVRNFVRQVDGVTKEFIRFLQESRNGG----AIDMLPKLTRLNLELTCLLTFGARLQSFTAQE 201
            .::||..:.|:|.::||||..|:..||..    ..|...:|.....|....:....|: ...:..
  Fly   173 VQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRM-GLLSDN 236

  Fly   202 QDPRSRSTRLMDAAETTNSCILPTDQGLQLWRFLETPSFRKLSQAQSYMESVALELVEENVRNGS 266
            .||  .:.||........:.....|....:|.|.:|..|:|..:....:..:....:|..:|   
  Fly   237 PDP--NADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMR--- 296

  Fly   267 VGSSLISAYVKNP------------ELDRSDVVGTAADLLLAGIDTTSYASAFLLYHIARNPEVQ 319
                   .:.||.            |.::...|....|:|:|||||||.|...:|||:||||..|
  Fly   297 -------GFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQ 354

  Fly   320 QKLHEEARRVLPSAKDELSMDALRTDITYTRAVLKESLRLNPIAVGVGRILNQDAIFSGYFVPKG 384
            :||..|..|:||:.||.|: |....::.|.||.:||.||:..|..|..||..:|.:.|||.||:|
  Fly   355 EKLRRELLRILPTTKDSLT-DQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRG 418

  Fly   385 TTVVTQNMVACRLEQHFQDPLRFQPDRWLQHRSA-----------LNPYLVLPFGHGMRACIARR 438
            |.|:...:.....:::|.....|.|:|||:...|           .||::.||||.|.|.||.:|
  Fly   419 TGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKR 483

  Fly   439 LAEQNMHILLLRLLREYELIW 459
            :||..:..||:||||.|::.|
  Fly   484 IAELEIETLLVRLLRSYKVSW 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dibNP_524810.2 p450 25..446 CDD:299894 140/455 (31%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 146/468 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24305
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.