DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cv-2 and bmper

Sequence 1:NP_524809.2 Gene:cv-2 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001018323.2 Gene:bmper ZFINID:ZDB-GENE-030219-146 Length:668 Species:Danio rerio

Alignment Length:615 Identity:217/616 (35%)
Similarity:302/616 (49%) Gaps:63/616 (10%)


  Fly    59 LSGVRQSCSNEGEEVQLKN---QPQIFTCFKCECQNGFVNCR-DTCPPV-NDCYILDKSNGTCCR 118
            ::|...||.||||.:.:.|   .|    |..|.|.|....|: :.|.|: .||.::.|..|.||.
Zfish    29 ITGTEASCENEGEVLHIPNITDNP----CISCVCLNQKAECKQEKCAPLAEDCALVVKQTGACCE 89

  Fly   119 RCKGCSFRGMSYESGSEWNDPEDPCKTYKCVATVVTETIQKCYSQCDNNQLQPPRPGECCPTCQG 183
            :||||..:|.||.|...|..|..||.||.|...|:||...:|...|.|.::.|.:   |||||.|
Zfish    90 KCKGCLLKGTSYNSSHHWISPVKPCVTYSCQEGVITEAEMRCVIHCKNPKIHPKK---CCPTCPG 151

  Fly   184 CKINGQTVAEGHEVDASIDDRCLVCQCRGTQLTCSKKTCPVLPCPMSKQIKRPDECCPRC-PQNH 247
            |...|....|..|.... .:.|:.|.|.|.|..|.|..||||.||.......|.:||||| .|..
Zfish   152 CIFEGNLYKEDEEFHPE-GNPCIKCVCTGGQSMCHKLVCPVLSCPSHLTHTPPGQCCPRCRGQRR 215

  Fly   248 SFLPVPGKCLFNKSVYPEKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEFQEPDGCCPRCAV 312
            .|...||.|||:..||...:....|.||.|||::.|.:|::...|...|     ....||..|. 
Zfish   216 VFDLSPGSCLFHSEVYENGSSISYDNCTTCTCVDSTVLCRKRCSPPGSC-----HGTACCEACQ- 274

  Fly   313 AEVRSE----CSLDGIVYQNNETWDMGPCRSCRCNGGTIRCAQMRC-PAVKCRANEELKQPPGEC 372
            :.::.|    |.:...:|::.:.|....|..|.|..|.|:|....| |...|.:|:.|.:.  .|
Zfish   275 SHLKMEDVKYCRVKSKIYRDGDRWSSVNCSLCTCVKGNIQCQPKICVPITSCPSNKILNRT--GC 337

  Fly   373 CQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLASDCM-GKTFHIRLTNEGRGTRRASWAK 436
            |..|.:..|.||||||||:.||||:.|:|||:|||:|..||. ..:|.:.:.|:.|.||..||.|
Zfish   338 CPVCTDKPGVCTVFGDPHYNTFDGRTFNFQGTCKYVLTKDCSPAASFTVLVKNDARRTRSFSWTK 402

  Fly   437 TVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGA 501
            :|.|....|.::|.|.:.|:.||||:.||:.  :.|.::.::    |..:.|.:..||.:.|:|.
Zfish   403 SVELHTSGLSISLHQHLTVRQNGTRIALPFH--STGVHIDLD----GYLLKLTTIAGLEITWDGD 461

  Fly   502 GFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGD-DEVWHFANSWKVGGPKSCS----R 561
            ..::|......|.:|||||||:||..|||..|.||:...| ||:   |.||:|...:.|.    |
Zfish   462 SLVEVVAAPHLKGQLCGLCGNYNGQRRDDSLGGDGQFKFDVDEL---AESWRVEDNELCEVQNRR 523

  Fly   562 KREFLAATP---------TCDKRKSNFYCHPLSVPALFGECNERLNPENYKAACRMDVCECP-SG 616
            ...||.|..         ||.|.||          ..|.:|:..::..::..:|..|:|||| ..
Zfish   524 PTSFLCAGTVKVKLRAHRTCQKLKS----------WEFQKCHSAVDFTSFYKSCVTDMCECPVHK 578

  Fly   617 DCHCDSFAAYAHECRRLGVQLPDWRSATNC 646
            :|.|:||.||:..|.|.|:.: .||....|
Zfish   579 NCFCESFIAYSRACEREGIHV-HWRPELTC 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 22/59 (37%)
VWC 256..310 CDD:278520 17/54 (31%)
VWC 319..376 CDD:214564 16/58 (28%)
VWD 371..536 CDD:214566 69/166 (42%)
C8 580..646 CDD:285899 19/67 (28%)
bmperNP_001018323.2 VWC 152..210 CDD:278520 22/59 (37%)
VWC 224..273 CDD:302663 17/54 (31%)
VWC 285..341 CDD:302663 16/58 (28%)
VWD 348..490 CDD:278521 62/148 (42%)
C8 539..607 CDD:285899 24/79 (30%)
TIL 612..665 CDD:280072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C126916643
eggNOG 1 0.900 E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H12494
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1104860at2759
OrthoFinder 1 1.000 FOG0008028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134638
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.660

Return to query results.
Submit another query.