DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cv-2 and Vwc2l

Sequence 1:NP_524809.2 Gene:cv-2 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_796138.2 Gene:Vwc2l MGIID:2444069 Length:222 Species:Mus musculus

Alignment Length:135 Identity:42/136 (31%)
Similarity:56/136 (41%) Gaps:21/136 (15%)


  Fly   262 VYPEKTQFMPDRCTNCTC---LNGTSVCQRPTCPILECAPEFQEPDGCCPRCAVAEVRSECSLDG 323
            ||....:|.|.. :||.|   |:| .||.:|.||.:.......|.:||||.|  .||::.|...|
Mouse    60 VYKLGERFFPGH-SNCPCVCALDG-PVCDQPECPKIHPKCTKVEHNGCCPEC--KEVKNFCEYHG 120

  Fly   324 IVYQNNETWDMGPCRSCRCN-GGTIRCAQMRCPAVKCRANEELKQP---PGECCQRCVE----TA 380
            ..|:..|.:...||..|||. ...:.|....|...:|      ..|   |.:||..|..    .|
Mouse   121 KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPEC------VNPIYEPEQCCPVCKNGPNCFA 179

  Fly   381 GTCTV 385
            ||..:
Mouse   180 GTTII 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564
VWC 256..310 CDD:278520 19/51 (37%)
VWC 319..376 CDD:214564 16/61 (26%)
VWD 371..536 CDD:214566 6/20 (30%)
C8 580..646 CDD:285899
Vwc2lNP_796138.2 VWC 116..171 CDD:327433 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97824976
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.800

Return to query results.
Submit another query.