DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cv-2 and Bmper

Sequence 1:NP_524809.2 Gene:cv-2 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001129271.1 Gene:Bmper RGDID:1563373 Length:685 Species:Rattus norvegicus

Alignment Length:672 Identity:226/673 (34%)
Similarity:314/673 (47%) Gaps:94/673 (14%)


  Fly    18 KSLASR--RRHTGFRPSTQLLILIAVLLALLQGRTVDAGAGDSLSGVRQSCSNEGEEVQ---LKN 77
            ::||.|  ||..|        |...|||.|.......:.|...|:|....|.||||.:|   :.:
  Rat     8 RALAERPCRRSPG--------ITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIPFITD 64

  Fly    78 QPQIFTCFKCECQNGFVNC-RDTCPPVN-DCYILDKSNGTCCRRCKGCSFRGMSYESGSEWNDPE 140
            .|    |..|.|.|..|.| |:.||.:: ||.:..|..|.||.|||||:..|.:|.|..:|..|.
  Rat    65 NP----CIMCVCSNKEVTCKREKCPVLSRDCALAIKQRGACCERCKGCTHEGRTYNSSFKWQSPA 125

  Fly   141 DPCKTYKCVATVVTETIQKCYSQCDNNQLQPPRPGECCPTCQGCKINGQTVAEGHEVDASIDDRC 205
            :||...:|...||||:..:|...|.|   ....||.|||||.||...|....||.|..... ::|
  Rat   126 EPCALRQCQEGVVTESEVRCVVHCKN---PAEHPGACCPTCPGCVFEGVQYREGEEFQPEA-NKC 186

  Fly   206 LVCQCRGTQLTCSKKTCPVLPCPMSKQIKRPDECCPRCPQNHSFLPVP-GKCLFNKSVYPEKTQF 269
            :.|.|.|.:..|.::.||:|.||.........:|||:|........:| |.|||...||.....|
  Rat   187 IKCSCVGGRTQCVREVCPILSCPQHLSHTPSGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGASF 251

  Fly   270 MPDRCTNCTCLNGTSVCQRPTCPILECA-PEF--QEPDGCCPRCAV---AEVRSECSLDGIVYQN 328
            :.|.||.|||.:.|.||::      :|: |..  .:.|.||..|.:   .|....|.....::::
  Rat   252 VYDNCTVCTCKDSTMVCKK------KCSHPGVCNTDEDACCEECLLRVPPEDVKVCKFGSKIFRD 310

  Fly   329 NETWDMGPCRSCRCNGGTIRCAQMRC-PAVKCRANEELKQPPGE------CCQRCVETAGTCTVF 386
            .|.|....|..|.|..|...|.:.:| |...|        |.|:      ||..|.|..|.||||
  Rat   311 GEMWSSVNCSICACVKGKTECRKKQCVPVSSC--------PQGKILNRKGCCPICTEKPGVCTVF 367

  Fly   387 GDPHFRTFDGKFFSFQGSCKYLLASDCM--GKTFHIRLTNEGRGTRRASWAKTVTLSLRNLKVNL 449
            ||||:.||||:.|:|||:|:|:|..||.  ...|.:.:.|:.|.||..||.|:|.|.|....|:|
  Rat   368 GDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKSVELVLGESTVSL 432

  Fly   450 GQRMRVKVNGTRVTL----PYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGAGFLQVSVPA 510
            .|.:.|:.||:|:.|    |:|.:.          .:|..:.:.:..||.:.|:|..|::|....
  Rat   433 QQHLTVRWNGSRIALPCHTPHFHID----------LDGYLLKVTTRAGLEISWDGDSFVEVMAAP 487

  Fly   511 KFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKVGGPKSCSRKRE----------- 564
            ..|.:|||||||:||..||||.|.||....|  |..||.||:|...:.|:|.:.           
  Rat   488 HLKGKLCGLCGNYNGHKRDDLIGGDGNFKFD--VDDFAESWRVESNEFCNRPQRKPVPELCQGTV 550

  Fly   565 --FLAATPTCDKRKSNFYCHPLSVPALFGECNERLNPENYKAACRMDVCECP-SGDCHCDSFAAY 626
              .|.|...|.|.||          ..|..|:..::...:..:|..|:|||| ..:|:|:||.||
  Rat   551 KVKLRAHRECQKLKS----------WEFQTCHSTVDYTTFYRSCVTDMCECPVHKNCYCESFLAY 605

  Fly   627 AHECRRLGVQLPDWRSATNCPA 648
            ...|:|.|::: .|....:|.|
  Rat   606 TRACQREGIKV-HWEPQQSCAA 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 18/59 (31%)
VWC 256..310 CDD:278520 20/57 (35%)
VWC 319..376 CDD:214564 15/64 (23%)
VWD 371..536 CDD:214566 70/177 (40%)
C8 580..646 CDD:285899 18/67 (27%)
BmperNP_001129271.1 VWC 166..224 CDD:278520 18/59 (31%)
VWC 301..357 CDD:302663 15/64 (23%)
VWD 364..508 CDD:278521 62/154 (40%)
C8 556..624 CDD:285899 23/79 (29%)
TIL 629..682 CDD:280072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C126946321
eggNOG 1 0.900 E1_KOG1216
Hieranoid 1 1.000
Homologene 1 1.000 H12494
Inparanoid 1 1.050 379 1.000 Inparanoid score I1977
OMA 1 1.010
OrthoDB 1 1.010 D1104860at2759
OrthoFinder 1 1.000 FOG0008028
OrthoInspector 1 1.000 T1089051
orthoMCL 1 0.900 OOG5_134638
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.710

Return to query results.
Submit another query.