DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosbeta5 and Prosalpha2

Sequence 1:NP_652014.1 Gene:Prosbeta5 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster

Alignment Length:182 Identity:41/183 (22%)
Similarity:75/183 (41%) Gaps:22/183 (12%)


  Fly    73 GTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECR 137
            |..::|.....||::|.:::.....|  .|.....||:....:|.:..|.....   |:|.|:.|
  Fly    32 GAPSVGIIASNGVVIATENKHKSPLY--EQHSVHRVEMIYNHIGMVYSGMGPDY---RLLVKQAR 91

  Fly   138 ----LHELRNKERISVAAASKIMANIAHEYKGMG----LSMGMMLAGYDKRGPGLYYVDSEGSRT 194
                .:.|..||.|.|:...:.:|.:..||...|    ..:.:::.|:|...|.||..|..|:..
  Fly    92 KIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSDPSGAYF 156

  Fly   195 PGNLFSVGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHA--TFRDAYSG 244
            .....::|..::.....|:..|..|||..:       |::.|  |.::.:.|
  Fly   157 AWKATAMGKNAVNGKTFLEKRYSEDLELDD-------AVHTAILTLKEGFEG 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 41/183 (22%)
proteasome_beta_type_5 74..261 CDD:239730 40/182 (22%)
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 41/183 (22%)
proteasome_alpha_type_2 6..231 CDD:239719 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78894790
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.