DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and sox4

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001039084.1 Gene:sox4 XenbaseID:XB-GENE-480727 Length:387 Species:Xenopus tropicalis

Alignment Length:375 Identity:110/376 (29%)
Similarity:160/376 (43%) Gaps:99/376 (26%)


  Fly    38 GGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHL 102
            ||:.:|.             .|      .|.|:.    ||||||||||||:|..||.:.:|.|.:
 Frog    44 GGKADDP-------------SW------CKTPSG----HIKRPMNAFMVWSQIERRKIMEQSPDM 85

  Fly   103 QNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEG--- 164
            .|:|:||.|||.||.|||.||.||:..||:||:.|..::|||||:||:|    :.|..|..|   
 Frog    86 HNAEISKRLGKRWKQLKDGDKIPFIREAERLRLKHMADYPDYKYRPRKK----VKSGGSKPGDKA 146

  Fly   165 -GSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGSCA------------STISHANVG 216
             ||||...:.:.:.| ||||....|:|.:...|.:....||:.|            |........
 Frog   147 CGSPGGSSSPTGSTG-SGKPPVKKSSGTKLCNKPHTKLVLGARAFPEQQPCIPDHHSLYKSRTAA 210

  Fly   217 SNSSD--------VFSNEAFMKS----------LNSACAASLMEQSLIETGLDSPCSTASSMS-- 261
            |...:        :|....:..|          |:|:.|.:....||.|.|..|..::..|.|  
 Frog   211 SGRQEKKPKHRVYIFGGAGYQGSPSVAVPASPTLSSSSAEASDPLSLYEDGSGSAQNSPGSPSEH 275

  Fly   262 ------SLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLE----AGREYVAI 316
                  |...|:|.:    |::.:|||::||......|.......|   .|||    .|.|.:::
 Frog   276 DGYTRASSPAPSTSH----SSSSSSAASSPSSASSSSSSSDEELED---ELLELNPSPGFENMSL 333

  Fly   317 GEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYP 366
            |..:    ||.:.         :::||     .:...:||...:|.|..|
 Frog   334 GSFS----SAALD---------RDLDF-----NFEPGSGSHFEFPDYCTP 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 42/70 (60%)
sox4NP_001039084.1 SOX-TCF_HMG-box 59..130 CDD:238684 43/71 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.