DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and sox19b

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_571777.1 Gene:sox19b ZFINID:ZDB-GENE-010111-1 Length:293 Species:Danio rerio

Alignment Length:281 Identity:84/282 (30%)
Similarity:124/282 (44%) Gaps:39/282 (14%)


  Fly    62 VQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPF 126
            |..:|..|.....:.:||||||||||::..||.|:::.|.:.|||:||.||..||.|.|.:|:||
Zfish    38 VSKTACPPGVDPMDKVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDVEKRPF 102

  Fly   127 MEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSP---GPEMTLSATMGSSGKPRSSNS 188
            ::.|::||..|.:|:|||||:||| |.:.|..:.:..|..|   |..:..:...|..|.||... 
Zfish   103 IDEAKRLRAVHMKEYPDYKYKPRR-KTKALMKKDNSVGKYPLAAGNLLASAVAQGQGGSPRMDG- 165

  Fly   189 NGQRRAGKGNAAADLGSCASTISH-ANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDS 252
                 .|.|:|...:|.....:.: ..:...........|....:|||.:.|.|..|      .|
Zfish   166 -----YGWGHAGGYMGMQGDALGYPQQLHRYDLSALQYPAAQPYMNSASSYSQMSYS------SS 219

  Fly   253 PCSTASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIG 317
            |...:..||.:.|  .|.:.:|:..                 |..:.|...|.|.:....|:..|
Zfish   220 PQQPSPVMSMVKP--EPLSHSPTGV-----------------PNHHRGAFQGDLRDMISMYIPGG 265

  Fly   318 ---EVNYQGQSAGVQSGAEGG 335
               |.:.|....|||....||
Zfish   266 DTSESSNQRAYPGVQQHYLGG 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/70 (53%)
sox19bNP_571777.1 SOX-TCF_HMG-box 52..123 CDD:238684 38/71 (54%)
SOXp 122..203 CDD:289133 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61566183
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.