DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and sox9b

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_571719.1 Gene:sox9b ZFINID:ZDB-GENE-001103-2 Length:407 Species:Danio rerio

Alignment Length:517 Identity:154/518 (30%)
Similarity:208/518 (40%) Gaps:177/518 (34%)


  Fly     3 DSSSSNCSKDRAKPVETLVLANYALKAEQKKAQGQGGRKEDER----ITTAVMKVLEGYDWNLVQ 63
            ||:.|.|:.           |.....:|..:|:....|.|.|:    |..||.:||:||||:||.
Zfish    23 DSAGSPCAS-----------AGSGSDSETPRAEPPLHRDEQEKFPVCIRDAVSQVLKGYDWSLVP 76

  Fly    64 ASAK-APTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFM 127
            ...: :.:.:.|.|:||||||||||||||||.::.|||||.|:||||:|||||:.|.:.:|:||:
Zfish    77 MPVRVSGSGKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNEGEKRPFV 141

  Fly   128 EFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQR 192
            |.||:||:.||::||||||||||:|     |.:||...|...|.|                    
Zfish   142 EEAERLRVQHKKDHPDYKYQPRRRK-----SVKSGSAESEDGEQT-------------------- 181

  Fly   193 RAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETG-LDSPCS- 255
                                         ..|..|..::|..|      |.....|| |.||.. 
Zfish   182 -----------------------------QISTNALFRALQRA------ETPDSSTGELHSPGEH 211

  Fly   256 TASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVN 320
            :..|....|||.||....|..:||.......   |....|:.: |..:|.        |.|||: 
Zfish   212 SGQSQGPPTPPTTPKTDLPVCSKADLKRERE---RDRERPLQD-GIDFGA--------VDIGEL- 263

  Fly   321 YQGQSAGVQS-----------------GAEG-GGAGQEMDFLENINGYGGYTGSRVSYP-AYSYP 366
                |:.|.|                 ||.| .|||..       :|||  :.:.:..| |.|..
Zfish   264 ----SSDVISNIEAFDVNEFDQYLPPHGAPGPAGAGFS-------SGYG--SAAWMHKPLASSSM 315

  Fly   367 ANGGHFATEEQQQQQALQASEALNYKPAAADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHHPLH 431
            ||.|     ||.||:|...:|.|:                                      |.|
Zfish   316 ANAG-----EQHQQRAQIKTEQLS--------------------------------------PGH 337

  Fly   432 HS--PPLNS--SASLSSACSSASSQQPVAEY-------YEHLGYSPAASSASQNPNFGPQQP 482
            :|  ||...  ||..|.|..:..|:|..|.|       |....|:|||::.:.:.:....||
Zfish   338 YSQQPPQQQFYSAPYSRAQYTEYSEQHSAYYSPYPTFSYSRPPYTPAAAADTAHTHHWDPQP 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 48/70 (69%)
sox9bNP_571719.1 Sox_N 16..80 CDD:289229 21/68 (31%)
SOX-TCF_HMG-box 90..160 CDD:238684 48/70 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45803
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.