DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and sox17a

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_989425.1 Gene:sox17a XenbaseID:XB-GENE-484295 Length:383 Species:Xenopus tropicalis

Alignment Length:444 Identity:114/445 (26%)
Similarity:177/445 (40%) Gaps:112/445 (25%)


  Fly    29 AEQKKAQGQGGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARR 93
            ||...:.|:|..|.|                    |.:.....:.:..|:||||||||||:..|:
 Frog    33 AEPMNSLGEGKLKSD--------------------AGSANSRGKAEARIRRPMNAFMVWAKDERK 77

  Fly    94 VMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPS 158
            .:::|.|.|.|:||||.|||.||.|..::|:||:|.||:||:.|.|:||:|||:|||:| :|...
 Frog    78 RLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRK-QVKRM 141

  Fly   159 QQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGSCASTISHANV--GSNSSD 221
            :::..|.....|...||.:|:.|:....:.:             ||....|..|:.:  ||:..:
 Frog   142 KRADTGFMHMAEPPESAVLGTDGRMCLESFS-------------LGYHEQTYPHSQLPQGSHYRE 193

  Fly   222 VFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASS--MSSLTPPATPYNVAPSNAKASAA-- 282
                       ..|.|......|| .|...||...|.:  :...:||.....:.|.:..||..  
 Frog   194 -----------PQAMAPHYDGYSL-PTPESSPLDLAEADPVFFTSPPQDECQMMPYSYNASYTHQ 246

  Fly   283 --NNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLE 345
              :..|:|:||:.                        :....||.:.|| |..|..:..:|    
 Frog   247 QNSGASMLVRQMP------------------------QAEQMGQGSPVQ-GMMGCQSSPQM---- 282

  Fly   346 NINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQASEALNYKPAAADIDPKEIDQYF--- 407
                |.|......|...:..|..|.:....|.||   :..::.:......|::|..|.:||.   
 Frog   283 ----YYGQMYLPGSARHHQLPQAGQNSPPPEAQQ---MGRADHIQQVDMLAEVDRTEFEQYLSYV 340

  Fly   408 --MDQMLPMTQHHHPHHTHPLHHPLHHSPPLNSSASLSSACSSASSQQPVAEYY 459
              .|    :..|:|...:         ..|...:..:||..|.||:    |.||
 Frog   341 AKSD----LGMHYHGQES---------VVPTADNGPISSVLSDAST----AVYY 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/70 (57%)
sox17aNP_989425.1 SOX-TCF_HMG-box 60..131 CDD:238684 41/71 (58%)
Sox17_18_mid 191..239 CDD:314876 11/60 (18%)
Required for transcriptional activity and interaction with ctnnb1. {ECO:0000250|UniProtKB:Q3KQ35} 332..337 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.