DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and sox8b

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001020636.1 Gene:sox8b ZFINID:ZDB-GENE-031114-1 Length:358 Species:Danio rerio

Alignment Length:490 Identity:134/491 (27%)
Similarity:169/491 (34%) Gaps:215/491 (44%)


  Fly    36 GQGGRKEDER----ITTAVMKVLEGYDWNLVQASAK-APTDRKKEHIKRPMNAFMVWAQAARRVM 95
            ||....||.|    |..||.:||:||||:||....: :.:.:.|.|:||||||||||||||||.:
Zfish    40 GQQAEDEDGRFPVCIRDAVSQVLKGYDWSLVPMPVRVSGSGKSKPHVKRPMNAFMVWAQAARRKL 104

  Fly    96 SKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQ 160
            :.|||||.|:||||:|||||:.|.:|:|:||:|.||:||:.||::||||||||||:|: |.|...
Zfish   105 ADQYPHLHNAELSKTLGKLWRLLTESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKS-VKPGHA 168

  Fly   161 SGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSN 225
            ..|.||...:....|..|..           |..|..:...|                       
Zfish   169 ESEAGSELMQHMYKAEPGMG-----------RLTGSPDHITD----------------------- 199

  Fly   226 EAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPYNVAPSNAKASAANNPSLLLR 290
                                         .|..:....|||.||....|...|            
Zfish   200 -----------------------------HTGHTHGPPTPPTTPKTEHPQAPK------------ 223

  Fly   291 QLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTG 355
                                                            |.:||            
Zfish   224 ------------------------------------------------QNIDF------------ 228

  Fly   356 SRVSYPAYSYPANGGHFATEEQQQQQALQASEALNYKPAAADIDPKEIDQYFMDQMLPMT----- 415
            |.|.....|....|.                         ...|.:|.|||     ||:|     
Zfish   229 SNVDISELSTDVIGN-------------------------LTFDLQEFDQY-----LPLTPDQGA 263

  Fly   416 ---------QHHHPHHTH-------PLHHPLHHSPPLNSSASLSSACSSASSQQPVAEYYEHLGY 464
                     .|.||...|       |.|:. .||..|.||:|.|:.|          ||.||..|
Zfish   264 CSRRAPPAGAHLHPQRVHIKTEQRSPQHYS-EHSSTLYSSSSSSAQC----------EYTEHSFY 317

  Fly   465 SPAASSASQNPNFGPQQPYANGAASMTPTLGDPAP 499
            ||.:|       :....||.:     .|.|..|||
Zfish   318 SPYSS-------YPYPYPYLH-----RPILNIPAP 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 49/70 (70%)
sox8bNP_001020636.1 Sox_N 1..75 CDD:289229 16/35 (46%)
SOX-TCF_HMG-box 85..155 CDD:238684 49/70 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61586558
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_141564
Panther 1 1.100 O PTHR45803
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.