DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and Sox21

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_008769164.1 Gene:Sox21 RGDID:1304724 Length:273 Species:Rattus norvegicus

Alignment Length:300 Identity:84/300 (28%)
Similarity:123/300 (41%) Gaps:75/300 (25%)


  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139
            :|:||||||||||::|.||.|:::.|.:.|||:||.||..||.|.:|:|:||::.|::||..|.:
  Rat     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70

  Fly   140 EHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLG 204
            |||||||:||||...:|...:....|:|.|..            |:..|...||||...|.   |
  Rat    71 EHPDYKYRPRRKPKTLLKKDKFAFPGAPTPGQ------------RADPSTRSRRAGLHRAG---G 120

  Fly   205 SCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATP 269
            :|...                     |.......:...:......:..|.|.|::.:...||   
  Rat   121 ACTRV---------------------SARRTPRTAARRRRCRPRAVFFPMSAAAARACRRPP--- 161

  Fly   270 YNVAPSNAKASAANNPSLLLRQLSE----PVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQS 330
                |:.... ... |...::.||     |.|::           |.....|...:.|::|...:
  Rat   162 ----PAAGSPXTRPXPGSKMQNLSXSSRLPYASS-----------RGPQTAGGAPFHGRAAAAAA 211

  Fly   331 GAEGGGAGQEMDFLENINGYGGYTGSRVS--YPAYSYPAN 368
            .|. .               ||:|.|..|  .|.|..|.|
  Rat   212 AAAXA---------------GGHTHSHPSPGNPGYMIPCN 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/70 (57%)
Sox21XP_008769164.1 SOX-TCF_HMG-box 7..78 CDD:238684 41/71 (58%)
SOXp 77..>96 CDD:289133 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.