DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and Sox7

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001099515.1 Gene:Sox7 RGDID:1310038 Length:383 Species:Rattus norvegicus

Alignment Length:517 Identity:115/518 (22%)
Similarity:154/518 (30%) Gaps:235/518 (45%)


  Fly    53 VLEGYDW---------------NLVQASAKAPTDRK--KEHIKRPMNAFMVWAQAARRVMSKQYP 100
            :|..|.|               .|...:...|:..|  :..|:||||||||||:..|:.::.|.|
  Rat     4 LLGAYPWTEGLECPALEAELSDGLSPPAVPRPSGDKGSESRIRRPMNAFMVWAKDERKRLAVQNP 68

  Fly   101 HLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGG 165
            .|.|:||||.|||.||.|..|.|:|:::.||:||:.|.|::|:|||:|||||             
  Rat    69 DLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKK------------- 120

  Fly   166 SPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMK 230
                                   .|:|...:    .|.|...|::|.                  
  Rat   121 -----------------------QGKRLCKR----VDPGFLLSSLSR------------------ 140

  Fly   231 SLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEP 295
                                                  ..|..|.  |.|....|          
  Rat   141 --------------------------------------DQNTLPE--KNSIGRGP---------- 155

  Fly   296 VANAGDGYGVLLEAGREYVAIGEVNYQGQSA------GVQSGAEGGGAGQEMDFLENINGYGGYT 354
                                :||...:|:.|      |:.|....|.|..              .
  Rat   156 --------------------LGEKEDRGEYAPGATLPGLHSCYREGAAAA--------------P 186

  Fly   355 GSRVSYPAYSYPANGGHFATEEQQQQQALQASEALNYKPAAADIDPKEIDQYFMDQMLPMTQHHH 419
            ||..:|| |..|.                        .|..:.:|..|.:|.|..... ..:|.|
  Rat   187 GSVDTYP-YGLPT------------------------PPEMSPLDALEPEQTFFSSSC-QEEHGH 225

  Fly   420 PHHTHPLHH-------------PLHHSPPLNSSASLS----SACSSASSQQPVAEYYEHLGYSPA 467
            |||   |.|             |||.|.||.|.|...    |..||.....|...||.|..|.|.
  Rat   226 PHH---LPHLPGPPYSPEFTPSPLHCSHPLGSLALGQSPGVSMMSSVPGCPPSPAYYSHATYHPL 287

  Fly   468 ASSASQNPNF---------GPQQPYAN--GAASMTPTLGDPAPQQELQSQQQEQQHQNPSQH 518
                  :||.         .|:.|..:  ...|....|||       ..:.:..|:.|...|
  Rat   288 ------HPNLQAHLGQLSPPPEHPGFDTLDQLSQVELLGD-------MDRNEFDQYLNTPGH 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 38/70 (54%)
Sox7NP_001099515.1 SOX-TCF_HMG-box 44..115 CDD:238684 39/71 (55%)
Sox_C_TAD 178..381 CDD:288887 48/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61532255
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.