DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and Sox21

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_808421.1 Gene:Sox21 MGIID:2654070 Length:276 Species:Mus musculus

Alignment Length:317 Identity:94/318 (30%)
Similarity:129/318 (41%) Gaps:106/318 (33%)


  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139
            :|:||||||||||::|.||.|:::.|.:.|||:||.||..||.|.:|:|:||::.|::||..|.:
Mouse     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70

  Fly   140 EHPDYKYQPRRKKARVL---------------------PSQQSGEGGSPGPEMTLSATMGSSGKP 183
            |||||||:||||...:|                     |:.::|.|        |.|..|....|
Mouse    71 EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGSVADAEHPALKAGAG--------LHAGAGGGLVP 127

  Fly   184 RSSNSNGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIET 248
            .|..:|.::.|....|||           |.|      .|...|...:..:|.||:....||::.
Mouse   128 ESLLANPEKAAAAAAAAA-----------ARV------FFPQSAAAAAAAAAAAAAGSPYSLLDL 175

  Fly   249 GLDSPCSTASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREY 313
            |  |..:..||.||..|.|:                      .|..|.|.||..:|         
Mouse   176 G--SKMAEISSSSSGLPYAS----------------------SLGYPTAGAGAFHG--------- 207

  Fly   314 VAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVS--YPAYSYPAN 368
                        |...:.|....|             ||:|.|..|  .|.|..|.|
Mouse   208 ------------AAAAAAAAAAAA-------------GGHTHSHPSPGNPGYMIPCN 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/70 (57%)
Sox21NP_808421.1 SOX-TCF_HMG-box 7..78 CDD:238684 41/71 (58%)
SOXp 77..>95 CDD:315092 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.