DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and LOC103694534

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_017457926.1 Gene:LOC103694534 RGDID:9176662 Length:162 Species:Rattus norvegicus

Alignment Length:86 Identity:44/87 (51%)
Similarity:67/87 (77%) Gaps:3/87 (3%)


  Fly    76 HIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQE 140
            |:||||||||||::..||.:::|.|.:||||:||.||..||:|.:::|:||.:.|::|:..|:::
  Rat     4 HVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKQLGYQWKSLTEAEKRPFFQEAQRLKTLHREK 68

  Fly   141 HPDYKYQPRRKKARVLPSQQS 161
            :|:|||||.|   ||..||:|
  Rat    69 YPNYKYQPHR---RVKVSQRS 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 35/70 (50%)
LOC103694534XP_017457926.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.