DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sox100B and sox8a

Sequence 1:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001271361.1 Gene:sox8a ZFINID:ZDB-GENE-130530-719 Length:401 Species:Danio rerio

Alignment Length:539 Identity:142/540 (26%)
Similarity:199/540 (37%) Gaps:219/540 (41%)


  Fly     2 SDSSSSNCSKD-----RAKPVETLVLANYALKAEQKKAQGQGGRKEDERITTAVMKVLEGYDWNL 61
            |||.||....|     .|.|.:|                 .|..:....|..||.:||:||||:|
Zfish    22 SDSPSSPSVSDDPGSRAAPPPDT-----------------DGDARFPVCIRDAVSQVLKGYDWSL 69

  Fly    62 VQASAKAPTDRK-KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKP 125
            |....:.....| |.|:||||||||||||||||.::.|||||.|:||||:|||||:.|.:|:|:|
Zfish    70 VPMPMQGSRSLKDKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRP 134

  Fly   126 FMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNG 190
            |:|.||:||:.||:::|||||||||:|: :.|.|...|.|:   |..|..|              
Zfish   135 FVEEAERLRLQHKKDYPDYKYQPRRRKS-LKPGQNEAEAGA---EKNLHHT-------------- 181

  Fly   191 QRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCS 255
                                         ..::..||.|::::        .|::.......|  
Zfish   182 -----------------------------DPIYKTEAGMRAMH--------HQTIHGVQPHGP-- 207

  Fly   256 TASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVN 320
                   .|||.||    .|:...|        :::|||                          
Zfish   208 -------PTPPTTP----KSDQHQS--------MKRLSE-------------------------- 227

  Fly   321 YQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQA 385
                           .|.|.:||            |.|.....|....|                
Zfish   228 ---------------NARQNIDF------------SNVDISELSSDVIG---------------- 249

  Fly   386 SEALNYKPAAADIDPKEIDQYFMDQMLPMTQHHHP---HHTHP------LHHPLHHSPPLNSSAS 441
                    :.:..|.:|.|||     ||:..|...   .|:.|      .||  |......:..|
Zfish   250 --------SISQFDVREFDQY-----LPLNGHTESGGGQHSSPGCFSTSFHH--HSGASAWNKPS 299

  Fly   442 LSSACSSASSQQPVAEYYE----HLGYSPAASSASQ---------NPNFGP---------QQPYA 484
            .|.:.|||:.|:|:.:..:    |.|.|..:.:.|:         :|.|..         |.||.
Zfish   300 GSPSTSSANQQRPLIKTEQLSPSHYGQSHGSPTQSELSDCADMQNSPYFTTFSGYPAGIYQYPYF 364

  Fly   485 NGA--ASMTP---TLGDPA 498
            :..  :.|||   ||..|:
Zfish   365 HSTRRSYMTPVLNTLSSPS 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 48/70 (69%)
sox8aNP_001271361.1 Sox_N <38..73 CDD:289229 15/52 (29%)
SOX-TCF_HMG-box 85..155 CDD:238684 48/70 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61586518
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T597247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45803
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.